DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and AT1G59960

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_176204.1 Gene:AT1G59960 / 842290 AraportID:AT1G59960 Length:326 Species:Arabidopsis thaliana


Alignment Length:325 Identity:110/325 - (33%)
Similarity:170/325 - (52%) Gaps:42/325 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ALLMAPKVRLSSG----HEMPVLGFGTYKLRGYQCSAA------------VHCAIETGFRHFDTA 82
            :|...|.:.:.||    |.||||||||         ||            |..||:.|:|||||:
plant     2 SLTTVPTLAIRSGPSGHHSMPVLGFGT---------AASPLPEPTMLKETVIEAIKLGYRHFDTS 57

  Fly    83 YYYENEKEIGEALRTQIKMGNI-SRENIFLTTKLWNTHHDPRDVRRICEKQLELLGFSYIDLYLM 146
            ..|:.|:.|||||...:.:|.: ||...|:|||||........|....::.|:.|...|:|||::
plant    58 PRYQTEEPIGEALAEAVSLGLVRSRSEFFVTTKLWCADAHGGLVVPAIKRSLKNLKLDYLDLYII 122

  Fly   147 HFPVG-----YKYVCDE-ILMPMSGDELQTVEIDYLDTWRAMENLVKLGMVRSIGLSNFNMEQIQ 205
            |:||.     ||:..|| ..|||          |:...|..||...:||:.:.||:|||:.:::|
plant   123 HWPVSSKPGKYKFPIDEDDFMPM----------DFEVVWSEMEECQRLGLAKCIGVSNFSCKKLQ 177

  Fly   206 RIIQCSSSKPVVNQVEIWPGFLQKDLVDYCRYNGIIVTAFSPLGQPNRKNHCPVYFFSEGMKRLV 270
            .|:..::..|.|||||:.|.:.|:.|.:.||.|.|:|||:|.||........|....|:.:|.:.
plant   178 HILSIATIPPSVNQVEMSPIWQQRKLRELCRSNDIVVTAYSVLGSRGAFWGTPKIMESDVLKEIA 242

  Fly   271 KKYKRSASQIVLRYLIDYGVVPIPKAANPIHIKENLNIFDFKLDEADTRLLRGIKPKSRIVKYEI 335
            :..:::.:|:.:|:..:.||..:.|:.....::|||.|||:.|.|.:|:.:....|:.|.|..|:
plant   243 EAKEKTVAQVSMRWAYEQGVSMVVKSFTKERLEENLKIFDWSLTEDETQRISTEIPQFRNVHGEV 307

  Fly   336  335
            plant   308  307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 107/317 (34%)
Tas 50..324 CDD:223739 100/292 (34%)
AT1G59960NP_176204.1 AKR_AKR4A_4B 18..299 CDD:381350 102/299 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.