DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and Akr1c6

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_085114.1 Gene:Akr1c6 / 83702 MGIID:1933427 Length:323 Species:Mus musculus


Alignment Length:314 Identity:124/314 - (39%)
Similarity:180/314 - (57%) Gaps:12/314 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VRLSSGHEMPVLGFGTY---KLRGYQCSAAVHCAIETGFRHFDTAYYYENEKEIGEALRTQIKMG 102
            ||||.||.:|:||||||   ::...:.:.|...||:.||||.|:|..|:||||:|.|:|::|..|
Mouse     8 VRLSDGHFIPILGFGTYAPQEVPKSKATEATKIAIDAGFRHIDSASMYQNEKEVGLAIRSKIADG 72

  Fly   103 NISRENIFLTTKLWNTHHDPRDVRRICEKQLELLGFSYIDLYLMHFPVGYKYVCDEILMPM-SGD 166
            .:.||:||.|:|:|.|.|.|..||...|:.|:.|...|:||||:|||:..|  ..|..:|. ...
Mouse    73 TVKREDIFYTSKVWCTFHRPELVRVCLEQSLKQLQLDYVDLYLIHFPMAMK--PGENYLPKDENG 135

  Fly   167 ELQTVEIDYLDTWRAMENLVKLGMVRSIGLSNFNMEQIQRIIQCS--SSKPVVNQVEIWPGFLQK 229
            :|....:|..|||.|||.....|:.:|||:||||..|:::|::..  ..|||.||||..|...|.
Mouse   136 KLIYDAVDICDTWEAMEKCKDAGLAKSIGVSNFNRRQLEKILKKPGLKYKPVCNQVECHPYLNQG 200

  Fly   230 DLVDYCRYNGIIVTAFSPLGQPNRK----NHCPVYFFSEGMKRLVKKYKRSASQIVLRYLIDYGV 290
            .|:|:||...|::.|:|.||....|    ...||...:..:..:.|||.|:.:.|.|||.:..||
Mouse   201 KLLDFCRSKDIVLVAYSALGSHREKQWVDQSSPVLLDNPVLGSMAKKYNRTPALIALRYQLQRGV 265

  Fly   291 VPIPKAANPIHIKENLNIFDFKLDEADTRLLRGIKPKSRIVKYEIVKDHMFYPF 344
            |.:.|:.:...||||:.:|:|:|...|.::|..:....|.:.....|||..:||
Mouse   266 VVLAKSFSEKRIKENMQVFEFQLTSEDMKVLDDLNKNIRYISGSSFKDHPDFPF 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 119/300 (40%)
Tas 50..324 CDD:223739 112/283 (40%)
Akr1c6NP_085114.1 ARA1 5..323 CDD:223729 124/314 (39%)
Tas 16..298 CDD:223739 112/283 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.