DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and AT5G62420

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_201048.1 Gene:AT5G62420 / 836363 AraportID:AT5G62420 Length:316 Species:Arabidopsis thaliana


Alignment Length:331 Identity:104/331 - (31%)
Similarity:182/331 - (54%) Gaps:42/331 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RLSSGHEMPVLGFGTYKLRGYQCS--------AAVHCAIETGFRHFDTAYYYENEKEIGEALRTQ 98
            ||..|..:|:||.|||      |.        :|||.||:.|:||||||..|.:|:.:|.||...
plant     7 RLRCGETIPLLGMGTY------CPQKDRESTISAVHQAIKIGYRHFDTAKIYGSEEALGTALGQA 65

  Fly    99 IKMGNISRENIFLTTKLWNT-HHDPRDVRRICEKQLELLGFSYIDLYLMHFPVGYKYVCDEILMP 162
            |..|.:.|:::|:|:|||:: ||||  :..:.: .|:.:|..|:|.||:|:|:..|....|   |
plant    66 ISYGTVQRDDLFVTSKLWSSDHHDP--ISALIQ-TLKTMGLDYLDNYLVHWPIKLKPGVSE---P 124

  Fly   163 MSGDELQTVEIDYLDTWRAMENLVKLGMVRSIGLSNFNMEQIQRIIQCSSSKPVVNQVEIWPGFL 227
            :..::....::...:||:.||..:::|:.||||:|||:.::|..::..:|..|.|||||:.|.:.
plant   125 IPKEDEFEKDLGIEETWQGMERCLEMGLCRSIGVSNFSSKKIFDLLDFASVSPSVNQVEMHPLWR 189

  Fly   228 QKDLVDYCRYNGIIVTAFSPLGQPNRKNHC---------PVYFFSEGMKRLVKKYKRSASQIVLR 283
            |:.|...|..|.|.|:.:||||.|   .:|         |:      :|.:..|:..:.:|:.||
plant   190 QRKLRKVCEENNIHVSGYSPLGGP---GNCWGSTAVIEHPI------IKSIALKHNATPAQVALR 245

  Fly   284 YLIDYGVVPIPKAANPIHIKENLNIFDFKLDEADTRLLRGIKPKSRIVKYEIVKDHMFYPFELLK 348
            :.:..|...|.|:.|...:.||....:.|||:.|..|:..:: :.:|::.:.:.:....|::.::
plant   246 WGMSKGASVIVKSFNGARMIENKRALEIKLDDQDLSLIDHLE-EWKIMRGDFLVNQTTSPYKSIQ 309

  Fly   349 E--NNE 352
            :  :||
plant   310 QLWDNE 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 101/307 (33%)
Tas 50..324 CDD:223739 97/291 (33%)
AT5G62420NP_201048.1 AKR_AKR4A_4B 10..288 CDD:381350 98/299 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - otm2923
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.