DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and AT5G01670

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_850750.1 Gene:AT5G01670 / 831701 AraportID:AT5G01670 Length:349 Species:Arabidopsis thaliana


Alignment Length:321 Identity:99/321 - (30%)
Similarity:170/321 - (52%) Gaps:38/321 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RLSSGHEMPVLGFGTYKLRGYQCSAAVHCAIETGFRHFDTAYYYENEKEIGEALRTQIKMGNISR 106
            ||.|||::|.:|.||::.......|.|...:|.|:||.|||:.|.:::|:|:.::..:..| :.|
plant    17 RLLSGHKIPAVGLGTWRSGSQAAHAVVTAIVEGGYRHIDTAWEYGDQREVGQGIKRAMHAG-LER 80

  Fly   107 ENIFLTTKLWN---------------------------THHDPRDVRRICEKQLELLGFSYIDLY 144
            .::|:|:|||.                           |...|..||...:..|:.|...|:|||
plant    81 RDLFVTSKLWYTLILRKMINLSSPLMNVLVGTCLNKRCTELSPERVRPALQNTLKELQLEYLDLY 145

  Fly   145 LMHFPVGYKYVCDEILMPMSGDELQTVEIDYLDTWRAMENLVKLGMVRSIGLSNFNMEQIQRIIQ 209
            |:|:|:..:....:  .|.:||.|   :.|....||.||||.|..:||:||:.||.:.::.:::.
plant   146 LIHWPIRLREGASK--PPKAGDVL---DFDMEGVWREMENLSKDSLVRNIGVCNFTVTKLNKLLG 205

  Fly   210 CSSSKPVVNQVEIWPGFLQKDLVDYCRYNGIIVTAFSPLG-QPNRKNHCPVYFFSEGMKRLVKKY 273
            .:...|.|.|:|:.||:....::::|:.|.|.|||:|||| |...::    ....:.:.|:.||.
plant   206 FAELIPAVCQMEMHPGWRNDRILEFCKKNEIHVTAYSPLGSQEGGRD----LIHDQTVDRIAKKL 266

  Fly   274 KRSASQIVLRYLIDYGVVPIPKAANPIHIKENLNIFDFKLDEADTRLLRGIKPKSRIVKYE 334
            .::..||::::.:..|...|||:.||..||||:.:||:.:.|.|.:.|..|..:.|::..|
plant   267 NKTPGQILVKWGLQRGTSVIPKSLNPERIKENIKVFDWVIPEQDFQALNSITDQKRVIDGE 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 98/317 (31%)
Tas 50..324 CDD:223739 91/301 (30%)
AT5G01670NP_850750.1 ARA1 11..317 CDD:223729 96/309 (31%)
Tas 13..317 CDD:223739 96/309 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.