DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and AKR4C11

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_190956.1 Gene:AKR4C11 / 824555 AraportID:AT3G53880 Length:315 Species:Arabidopsis thaliana


Alignment Length:331 Identity:105/331 - (31%)
Similarity:172/331 - (51%) Gaps:40/331 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 MAPKV---RLSSGHEMPVLGFGTYKLRGYQCSAAVHCAIETGFRHFDTAYYYENEKEIGEALRTQ 98
            ||.::   :|::|.::|.:|.||::........||..|::.|::|.|.|..|.||.|||:.|:..
plant     1 MADEIGFFQLNTGAKIPSVGLGTWQAAPGVVGDAVAAAVKIGYQHIDCASRYGNEIEIGKVLKKL 65

  Fly    99 IKMGNISRENIFLTTKLWNTHHDPRDVRRICEKQLELLGFSYIDLYLMHFPVGYKY-VCD---EI 159
            ...|.:.||.:|:|:|:|.|..||.||:....:.|:.|...|:||||||:||..|. ..|   |.
plant    66 FDDGVVKREKLFITSKIWLTDLDPPDVQDALNRTLQDLQLDYVDLYLMHWPVRLKKGTVDFKPEN 130

  Fly   160 LMPMSGDELQTVEIDYLDTWRAMENLVKLGMVRSIGLSNFNMEQIQRIIQCSSSKPVVNQVEIWP 224
            :||          ||...||:|||.||..|..|:||:|||:.:::..:::.:...|.|||||..|
plant   131 IMP----------IDIPSTWKAMEALVDSGKARAIGVSNFSTKKLSDLVEAARVPPAVNQVECHP 185

  Fly   225 GFLQKDLVDYCRYNGIIVTAFSPLGQPNRKNHCPVYFFSEGMKRLVKKYKRSASQIVLRYLIDYG 289
            .:.|..|.::|:..||.::.:||||.|...........|..::.:.|:..:|.:|..||:.:..|
plant   186 SWQQHKLHEFCKSKGIHLSGYSPLGSPGTTWVKADVLKSPVIEMIAKEIGKSPAQTALRWGLQMG 250

  Fly   290 VVPIPKAANPIHIKENLNIFDFKLDEADTRLLRGIKPK------SRIVKYEIVKDHMFY-----P 343
            ...:||:.|...|:||.::..:.:            ||      |:|.:..:|:...|.     |
plant   251 HSILPKSTNEGRIRENFDVLGWSI------------PKEMFDKFSKIEQARLVQGTSFVHETLSP 303

  Fly   344 FELLKE 349
            ::.|:|
plant   304 YKTLEE 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 100/307 (33%)
Tas 50..324 CDD:223739 92/277 (33%)
AKR4C11NP_190956.1 AKR_AKR4C1-15 6..292 CDD:381351 98/307 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - otm2923
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.