DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and AKR4C8

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_565871.1 Gene:AKR4C8 / 818353 AraportID:AT2G37760 Length:311 Species:Arabidopsis thaliana


Alignment Length:293 Identity:104/293 - (35%)
Similarity:163/293 - (55%) Gaps:35/293 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 MAPKVR---LSSGHEMPVLGFGTYKLRGYQCSAAVHCAIETGFRHFDTAYYYENEKEIGEALRTQ 98
            ||..:|   |::|.::|.:|.|||.:    .:.|:..||:.|:||.|.|..|.||||||..|:..
plant     1 MAAPIRFFELNTGAKLPCVGLGTYAM----VATAIEQAIKIGYRHIDCASIYGNEKEIGGVLKKL 61

  Fly    99 IKMGNISRENIFLTTKLWNTHHDPRDVRRICEKQLELLGFSYIDLYLMHFPVGYKYVCDEILMPM 163
            |..|.:.||.:|:|:|||:..|.|.||.:..||.|:.|...|:||||:|:|...|   .|.|||.
plant    62 IGDGFVKREELFITSKLWSNDHLPEDVPKALEKTLQDLQIDYVDLYLIHWPASLK---KESLMPT 123

  Fly   164 SGDELQTVEIDYLDTWRAMENLVKLGMVRSIGLSNFNMEQIQRIIQCSSSKPVVNQVEIWPGFLQ 228
              .|:.| :.|...||:|||.|...|..|:||:|||:.:::..::..:...|.|||||..|.:.|
plant   124 --PEMLT-KPDITSTWKAMEALYDSGKARAIGVSNFSSKKLTDLLNVARVTPAVNQVECHPVWQQ 185

  Fly   229 KDLVDYCRYNGIIVTAFSPLGQPNRKNHCPVYFFSEGMKRL-----------VKKYKRSASQIVL 282
            :.|.:.|:..|:.::.:||||..           |:|..||           .:|..::.:|:.|
plant   186 QGLHELCKSKGVHLSGYSPLGSQ-----------SKGEVRLKVLQNPIVTEVAEKLGKTTAQVAL 239

  Fly   283 RYLIDYGVVPIPKAANPIHIKENLNIFDFKLDE 315
            |:.:..|...:||:::...:||||::||:.:.|
plant   240 RWGLQTGHSVLPKSSSGARLKENLDVFDWSIPE 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 104/293 (35%)
Tas 50..324 CDD:223739 99/277 (36%)
AKR4C8NP_565871.1 AKR_AKR4C1-15 6..288 CDD:381351 102/288 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - otm2923
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.