DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and akr1c3

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001072181.1 Gene:akr1c3 / 779627 XenbaseID:XB-GENE-5821909 Length:324 Species:Xenopus tropicalis


Alignment Length:322 Identity:115/322 - (35%)
Similarity:173/322 - (53%) Gaps:28/322 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VRLSSGHEMPVLGFGTYKLRGYQCSAA---VHCAIETGFRHFDTAYYYENEKEIGEALRTQIKMG 102
            |.|:.||:|||:|||||....:..|.|   ...||:.|:||.|.|:.|.||:|:|.|:|.:|..|
 Frog     9 VELNDGHKMPVIGFGTYAPPKFPKSLAEEGTKVAIDVGYRHIDCAFLYGNEEEVGRAIRAKIADG 73

  Fly   103 NISRENIFLTTKLWNTHHDPRDVRRICEKQLELLGFSYIDLYLMHFPVGYKYVCDEILMPMSGDE 167
            .:.||::|.|.|||:|.|.|..||...||.|:.|...|:||:::|.|:.:|          .||:
 Frog    74 TVKREDVFYTGKLWSTSHTPERVRPALEKSLKDLQLDYMDLFIIHMPMEFK----------PGDD 128

  Fly   168 LQTVE---------IDYLDTWRAMENLVKLGMVRSIGLSNFNMEQIQRIIQCS--SSKPVVNQVE 221
            |...:         .|..|||:|:|.....|:|||||:||||.:|::.|:...  ..|||.||||
 Frog   129 LFPADENGKFIYHNTDLRDTWKALEKCKDAGLVRSIGVSNFNHKQLELILNMPGLKYKPVCNQVE 193

  Fly   222 IWPGFLQKDLVDYCRYNGIIVTAFSPLGQPNRKN----HCPVYFFSEGMKRLVKKYKRSASQIVL 282
            ......|..|:::|:...|::..:|.||....:.    ..||......:..:.||:.|:.:|:.:
 Frog   194 CHVYLNQSKLLEFCKSKDIVLVGYSVLGSSRDERWIEASTPVLLEDPALTEIAKKHNRTPAQVAM 258

  Fly   283 RYLIDYGVVPIPKAANPIHIKENLNIFDFKLDEADTRLLRGIKPKSRIVKYEIVKDHMFYPF 344
            ||.:..|||.:.|:..|..|::|..:|||:||..|.|.:.|:....|.:......||..||:
 Frog   259 RYHLQRGVVVLAKSFTPARIQQNFQVFDFQLDAEDMRSIDGLNRNMRYIDTSRWSDHPKYPY 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 111/308 (36%)
Tas 50..324 CDD:223739 104/291 (36%)
akr1c3NP_001072181.1 AKR_AKR1C1-35 8..308 CDD:381334 111/308 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm9378
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.