DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and Akr1e1

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_061347.2 Gene:Akr1e1 / 56043 MGIID:1914758 Length:301 Species:Mus musculus


Alignment Length:300 Identity:110/300 - (36%)
Similarity:176/300 - (58%) Gaps:6/300 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 MPVLGFGTYKLRGYQCSAAVHCAIETGFRHFDTAYYYENEKEIGEALRTQIKMGNISRENIFLTT 113
            :|.:|.||:|....:.:.||..||..|:||||.||.|.||.|:|..:..:||.|.:.||::|:.:
Mouse     4 IPTVGLGTWKASPGEVTDAVKLAINLGYRHFDCAYLYHNESEVGMGISEKIKEGVVKREDLFVVS 68

  Fly   114 KLWNTHHDPRDVRRICEKQLELLGFSYIDLYLMHFPVGYKYVCDEILMPMSGDELQTVEIDYLDT 178
            |||.|.|....|:..|...||.|...|:||||:|:|:|:|....:|.:..:|..:.: ...:|||
Mouse    69 KLWCTCHKKSLVKTACTNTLEALNLDYLDLYLIHWPMGFKPGEKDIPLDRNGKVIPS-HTSFLDT 132

  Fly   179 WRAMENLVKLGMVRSIGLSNFNMEQIQRIIQCSS--SKPVVNQVEIWPGFLQKDLVDYCRYNGII 241
            |.|||:||..|:|:::|:||||.||::|::....  .:|:.||:|..|...||.|:|:|....:.
Mouse   133 WEAMEDLVFEGLVKNLGVSNFNHEQLERLLDKPGLRVRPITNQIECHPYLNQKKLIDFCHKRNVS 197

  Fly   242 VTAFSPLGQPNRKNHCPVYFFSEGMKRLVKKYKRSASQIVLRYLIDYGVVPIPKAANPIHIKENL 306
            |||:.|||......|   ......::::.||:.:|.:||::|:.|...::.|||:..|..|:||:
Mouse   198 VTAYRPLGGSGGGFH---LMDDTVIRKIAKKHGKSPAQILIRFQIQRNLIVIPKSVTPSRIRENI 259

  Fly   307 NIFDFKLDEADTRLLRGIKPKSRIVKYEIVKDHMFYPFEL 346
            .:|||:|.|.|...|..:....|:..:...::|..|||.:
Mouse   260 QVFDFELTEKDMEELLSLDKNLRLATFPTTENHQDYPFHI 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 106/284 (37%)
Tas 50..324 CDD:223739 105/275 (38%)
Akr1e1NP_061347.2 Tas 4..287 CDD:223739 106/286 (37%)
ARA1 4..282 CDD:223729 105/281 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.