DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and zgc:110782

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001013503.1 Gene:zgc:110782 / 541358 ZFINID:ZDB-GENE-050320-51 Length:287 Species:Danio rerio


Alignment Length:306 Identity:97/306 - (31%)
Similarity:159/306 - (51%) Gaps:35/306 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LMAPKVRLSSGHEMPVLGFGTYKLRGY-QCSAAVHCAIETGFRHFDTAYYYENEKEIGEALRTQI 99
            ::.|.|||.||.:||:||.|||||:.: |...:|.||::.|:|.||||..|.||..:|:.|:..:
Zfish     1 MIVPSVRLMSGTQMPLLGLGTYKLQDHEQLKQSVSCALQAGYRAFDTAAVYGNEAHLGQVLKELL 65

  Fly   100 KMGNISRENIFLTTKLWNTHHDPRDVRRICEKQLELLGFSYIDLYLMHFPVGYKYVCDEILMPMS 164
            ....:.||::|:.:||..:.|..| .:..|.:.||.|...||||||:|:|            .|.
Zfish    66 PKYGLIREDVFIISKLAPSDHGLR-AKEGCLRSLEQLDCEYIDLYLIHWP------------GME 117

  Fly   165 G-DELQTVEIDY-LDTWRAMENLVKLGMVRSIGLSNFNMEQIQRIIQCSSSKPVVNQVEIWPGFL 227
            | |...:...:| ..:|..:|.....|..::||:||:..:.|:.::......|.|.|:|..|..:
Zfish   118 GLDPEDSRHSEYRAQSWATLEEFHASGQFKAIGVSNYTAKHIRELLASCRVPPAVLQIECQPKLI 182

  Fly   228 QKDLVDYCRYNGIIVTAFSPLG------QPNRKNHCPVYFFSEGMKRLVKKYKRSASQIVLRYLI 286
            |::|.|.|...||...|:|.||      :|.             :..:|:...|:.:|::||:.:
Zfish   183 QRELRDLCMETGIHFQAYSSLGKGALLREPE-------------VMDIVRHCGRTPAQVLLRWAL 234

  Fly   287 DYGVVPIPKAANPIHIKENLNIFDFKLDEADTRLLRGIKPKSRIVK 332
            ..|:..:|:::.|..:.||..:|||||:|.|.:.|..:...:|..|
Zfish   235 QQGISVLPRSSQPSRVLENAQVFDFKLNETDMKRLDDLNCGTRFCK 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 96/303 (32%)
Tas 50..324 CDD:223739 88/282 (31%)
zgc:110782NP_001013503.1 ARA1 1..280 CDD:223729 96/304 (32%)
Tas 17..271 CDD:223739 87/279 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594358
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.640

Return to query results.
Submit another query.