DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and Akr1c12l1

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001129216.1 Gene:Akr1c12l1 / 498790 RGDID:1559604 Length:323 Species:Rattus norvegicus


Alignment Length:325 Identity:121/325 - (37%)
Similarity:178/325 - (54%) Gaps:34/325 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VRLSSGHEMPVLGFGTY------KLRGYQCSAAVHCAIETGFRHFDTAYYYENEKEIGEALRTQI 99
            |:|:.||.:|.|||||.      |.:..:   |||.||:.|:.|.|||..|:.|:|||:|::::|
  Rat     8 VKLNDGHFIPALGFGTSIPNEVPKSKSLE---AVHLAIDAGYHHIDTASAYQIEEEIGQAIQSKI 69

  Fly   100 KMGNISRENIFLTTKLWNTHHDPRDVRRICEKQLELLGFSYIDLYLMHFPVGYKYVCDEILMPMS 164
            |.|.:.||::|:|||||.|...|..|:...||.|:.|...|.|||:||:||..|          |
  Rat    70 KAGVVKREDMFITTKLWCTCFRPELVKPALEKSLKNLQLDYADLYIMHYPVPMK----------S 124

  Fly   165 GDELQTVE---------IDYLDTWRAMENLVKLGMVRSIGLSNFNMEQIQRIIQCS--SSKPVVN 218
            ||:...|:         :|:.|||..:|.....|:|:|||:||||.:|::|::...  ..|||.|
  Rat   125 GDKYLPVDDKGKWLLDTVDFCDTWEMLEKCKDAGLVKSIGVSNFNHKQLERLLNKPGLKYKPVCN 189

  Fly   219 QVEIWPGFLQKDLVDYCRYNGIIVTAFSPLGQPNRK----NHCPVYFFSEGMKRLVKKYKRSASQ 279
            |||......|..|:|||:...|::.|:..||....|    .:.||......:..:.||.|||.:.
  Rat   190 QVECHLYMNQSKLLDYCKSKDIVLVAYGALGTQRYKEWVDQNSPVLLDDPVLCDVAKKNKRSPAL 254

  Fly   280 IVLRYLIDYGVVPIPKAANPIHIKENLNIFDFKLDEADTRLLRGIKPKSRIVKYEIVKDHMFYPF 344
            |.||||:...|||:.::.....::|||.:|:|:|...|.:.|.|:....|.:..|.:..|..|||
  Rat   255 IALRYLVQREVVPLAQSFKENEMRENLQVFEFQLSPEDMKTLDGLNKNFRYLSAEFLAGHPEYPF 319

  Fly   345  344
              Rat   320  319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 116/311 (37%)
Tas 50..324 CDD:223739 110/294 (37%)
Akr1c12l1NP_001129216.1 ARA1 8..305 CDD:223729 115/309 (37%)
Tas 16..297 CDD:223739 109/293 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm8954
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.