DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and RGD1564865

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001157868.1 Gene:RGD1564865 / 498789 RGDID:1564865 Length:323 Species:Rattus norvegicus


Alignment Length:313 Identity:116/313 - (37%)
Similarity:173/313 - (55%) Gaps:10/313 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VRLSSGHEMPVLGFGTY---KLRGYQCSAAVHCAIETGFRHFDTAYYYENEKEIGEALRTQIKMG 102
            |.||.|..||:||:||:   ::...:...:...||:.||||.|:||.|:||||:|||:|::|..|
  Rat     8 VELSDGRLMPLLGYGTFQNPEIPASKILESTKIAIDIGFRHIDSAYVYKNEKEVGEAIRSKITGG 72

  Fly   103 NISRENIFLTTKLWNTHHDPRDVRRICEKQLELLGFSYIDLYLMHFPVGYKYVCDEILMPMSGDE 167
            .:.||:||||||||:|.|.|..||...|:.|:.....|:||||:|:|:..| ..:||.......:
  Rat    73 VVKREDIFLTTKLWSTFHRPELVRVGLERSLKSFQLDYVDLYLIHYPISIK-PSEEIYTKDENGK 136

  Fly   168 LQTVEIDYLDTWRAMENLVKLGMVRSIGLSNFNMEQIQRIIQCSSSK--PVVNQVEIWPGFLQKD 230
            :....:|....|.|||.....|:.:|||:||||..|::.|:.....|  ||.||||..|...|..
  Rat   137 ILFETVDLCAIWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKHRPVCNQVECHPYLNQSK 201

  Fly   231 LVDYCRYNGIIVTAFSPLGQPNRKN----HCPVYFFSEGMKRLVKKYKRSASQIVLRYLIDYGVV 291
            |:|:|:...|::.|::.||.....|    :.|.......:..:.||:.||.:||.|||.:..|||
  Rat   202 LMDFCKSQDIVLVAYAALGSQRPTNWVDKNAPFLLNDPVLGGMAKKHNRSPAQIALRYQVQRGVV 266

  Fly   292 PIPKAANPIHIKENLNIFDFKLDEADTRLLRGIKPKSRIVKYEIVKDHMFYPF 344
            .:.:......:|||:.:|:|:|...|..:|.|:....|.....|..:|..||:
  Rat   267 ALAQTYEQKEMKENIQVFEFQLPSEDMEVLDGLNRNFRYFPVNIAAEHPNYPY 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 112/299 (37%)
Tas 50..324 CDD:223739 105/282 (37%)
RGD1564865NP_001157868.1 ARA1 8..311 CDD:223729 112/303 (37%)
Tas 19..297 CDD:223739 103/278 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm8954
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.