DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and akr1b1

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001011130.1 Gene:akr1b1 / 496546 XenbaseID:XB-GENE-5821742 Length:318 Species:Xenopus tropicalis


Alignment Length:318 Identity:126/318 - (39%)
Similarity:189/318 - (59%) Gaps:24/318 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VRLSSGHEMPVLGFGTYKLRGYQCSAAVHCAIETGFRHFDTAYYYENEKEIGEALRTQIKMGNIS 105
            |:|.:|.:||::|.||:|....:.:|||..|||.|:||.|.||.|:||.|:||.::.:||.|.:.
 Frog     7 VQLYTGAQMPIVGLGTWKSEPGKVTAAVAKAIEVGYRHLDCAYVYQNENEVGEGIQQKIKEGLVK 71

  Fly   106 RENIFLTTKLWNTHHDPRDVRRICEKQLELLGFSYIDLYLMHFPVGYKYVCDEILMPMSGDELQT 170
            ||::|:.:|||:|.||...|:..|:|.|..|...|:||||:|:|.|::          :||.|..
 Frog    72 REDLFVVSKLWSTFHDKSMVKGACQKTLSDLKLDYLDLYLVHWPTGFQ----------AGDALFP 126

  Fly   171 VEID---------YLDTWRAMENLVKLGMVRSIGLSNFNMEQIQRIIQCS--SSKPVVNQVEIWP 224
            ::.:         :||||..||.||..|:|::||:||||.|||::::...  ..||.|:|.|..|
 Frog   127 LDNEGCVIHSNTHFLDTWEGMEELVDAGLVKAIGISNFNREQIEQLLNKPGLKHKPAVHQFECHP 191

  Fly   225 GFLQKDLVDYCRYNGIIVTAFSPLGQPNR---KNHCPVYFFSEGMKRLVKKYKRSASQIVLRYLI 286
            ...||.|:|.|:..||:|||:||||.|:|   |...|.......:|.:.|||.::::|:::|:.|
 Frog   192 YLTQKKLIDLCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEEPKIKEIAKKYNKTSAQVLIRFHI 256

  Fly   287 DYGVVPIPKAANPIHIKENLNIFDFKLDEADTRLLRGIKPKSRIVKYEIVKDHMFYPF 344
            ...||.|||:..|..|:||..:|||:|...||..:...:...|:......|.|..|||
 Frog   257 QRNVVVIPKSVTPARIEENFQVFDFELSPEDTEAIFSFERGWRVCALSSAKKHKDYPF 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 121/304 (40%)
Tas 50..324 CDD:223739 116/287 (40%)
akr1b1NP_001011130.1 AKR_AKR1B1-19 12..318 CDD:381333 124/313 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.