DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and akr1c4

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_031753743.1 Gene:akr1c4 / 496490 XenbaseID:XB-GENE-5895888 Length:328 Species:Xenopus tropicalis


Alignment Length:324 Identity:114/324 - (35%)
Similarity:174/324 - (53%) Gaps:34/324 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KVRLSSGHEMPVLGFGTY------KLRGYQCSAAVHCAIETGFRHFDTAYYYENEKEIGEALRTQ 98
            ::.|..|:.:||:|.|||      |..|   :.|...||:.|:||.|.||.|.||.:||||:|::
 Frog    16 RLTLHDGNAIPVMGLGTYASAEVPKSDG---TEATKLAIDLGYRHIDCAYIYGNEVQIGEAIRSK 77

  Fly    99 IKMGNISRENIFLTTKLWNTHHDPRDVRRICEKQLELLGFSYIDLYLMHFPVGYKYVCDEILMPM 163
            |..|.:.||.||.|.|||.:...|..||:..|..|:.|...|:||::||:|...|        |.
 Frog    78 IADGTVKREEIFYTGKLWCSFFSPNLVRQGLEASLKALQLDYLDLFIMHWPFSVK--------PS 134

  Fly   164 SGDELQTVEIDYLD---TWRAMENLVKLGMVRSIGLSNFNMEQIQRIIQCS--SSKPVVNQVEIW 223
            .....|.::.|.:|   ||.|:|.....|:|:|||:||||..|::|::...  ..|||.||||..
 Frog   135 DAHSNQPLDFDDVDFCLTWEALEGCKDAGLVKSIGVSNFNRRQLERLLSKPGLKYKPVCNQVEYH 199

  Fly   224 PGFLQKDLVDYCRYNGIIVTAFSPLG--------QPNRKNHCPVYFFSEGMKRLVKKYKRSASQI 280
            ....|..|.:||:.:.|::.|:|.||        .||    .||......::.:..||.||.:::
 Frog   200 VYLNQSKLHEYCKCHNIVLVAYSVLGTARDNTWVDPN----SPVLLEDPVLRSVAAKYNRSPAEV 260

  Fly   281 VLRYLIDYGVVPIPKAANPIHIKENLNIFDFKLDEADTRLLRGIKPKSRIVKYEIVKDHMFYPF 344
            .:|:::..|.|.:.|:.||..:|:||.:|:|:|...|..:|.|:....|..::.::|.|..|||
 Frog   261 AMRFILQKGAVVLAKSFNPTRLKQNLGVFEFELKPEDMEMLDGLNRNLRYAQFTVMKQHPEYPF 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 109/310 (35%)
Tas 50..324 CDD:223739 105/292 (36%)
akr1c4XP_031753743.1 AKR_SF 15..313 CDD:412396 109/311 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm9378
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.