DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and zgc:101765

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001006056.1 Gene:zgc:101765 / 450036 ZFINID:ZDB-GENE-041010-156 Length:288 Species:Danio rerio


Alignment Length:291 Identity:101/291 - (34%)
Similarity:163/291 - (56%) Gaps:27/291 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PKVRLSSGHEMPVLGFGTYKLRGYQCS-AAVHCAIETGFRHFDTAYYYENEKEIGEALRTQIKMG 102
            |.|.|::..:||:||.||::|:|.:.: :||..|::.|:|.||||..|.||..:|.|||..:...
Zfish     6 PSVLLNNDIQMPLLGLGTFRLQGQEDTYSAVDAALKAGYRAFDTAAVYRNEAHLGHALRCLLPKH 70

  Fly   103 NISRENIFLTTKLWNTHHDPRD----VRRICEKQLELLGFSYIDLYLMHFPVGYKYVCDEILMPM 163
            .:|||::|:|:||     .|:|    .|..|:|.||.||..||||||:|:| |.:.      :|:
Zfish    71 GLSREDVFITSKL-----GPKDQGSKARNGCQKSLEQLGLGYIDLYLIHWP-GTQG------LPV 123

  Fly   164 SGDELQTVEIDYLDTWRAMENLVKLGMVRSIGLSNFNMEQIQRIIQCSSSKPVVNQVEIWPGFLQ 228
             ||:....  :...:||.:|.....|..|:||:||:.:|.:|.:::.....|.|.|||..|..||
Zfish   124 -GDKRNPE--NRAQSWRVLEEFYSEGKFRAIGVSNYTVEHMQELLKSCKVPPAVLQVEFHPKLLQ 185

  Fly   229 KDLVDYCRYNGIIVTAFSPLGQPNRKNHCPVYFFSEGMKRLVKKYKRSASQIVLRYLIDYGVVPI 293
            .||...|:..|:...|:|.||.....:: ||      :..:.|:..|:.:|::||:.:...:..:
Zfish   186 NDLRGLCKIRGVCFQAYSSLGTGLLLSN-PV------VLEIAKECGRTPAQVLLRWAVQQSIAVL 243

  Fly   294 PKAANPIHIKENLNIFDFKLDEADTRLLRGI 324
            ||::.|..:|||..:|||::.|.|...|..:
Zfish   244 PKSSQPERVKENGRLFDFEISEEDMERLSAL 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 101/291 (35%)
Tas 50..324 CDD:223739 97/278 (35%)
zgc:101765NP_001006056.1 ARA1 5..283 CDD:223729 101/291 (35%)
Tas 11..271 CDD:223739 97/281 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594353
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.640

Return to query results.
Submit another query.