DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and AKR1B15

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001074007.2 Gene:AKR1B15 / 441282 HGNCID:37281 Length:344 Species:Homo sapiens


Alignment Length:307 Identity:110/307 - (35%)
Similarity:171/307 - (55%) Gaps:30/307 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LRGYQCS------AAVHCAIETGFRHFDTAYYYENEKEIGEALRTQIKMGNISRENIFLTTKLWN 117
            ||.|..|      .||..||:..:||.|.||:|||:.|:|||::.:|:...:.||::|:.:|:|.
Human    45 LRPYPASLLGKVKEAVKVAIDAEYRHIDCAYFYENQHEVGEAIQEKIQEKAVMREDLFIVSKVWP 109

  Fly   118 THHDPRDVRRICEKQLELLGFSYIDLYLMHFPVGYKYVCDEILMPMSGDE---------LQTVEI 173
            |..:...||:..||.|:.|..||:|:||:|:|.|:|          :||:         :.:.:.
Human   110 TFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFK----------TGDDFFPKDDKGNMISGKG 164

  Fly   174 DYLDTWRAMENLVKLGMVRSIGLSNFNMEQIQRIIQCS--SSKPVVNQVEIWPGFLQKDLVDYCR 236
            .:||.|.|||.||..|:|:::|:||||..||:|::...  ..|||.||||..|...|:.|:.||.
Human   165 TFLDAWEAMEELVDEGLVKALGVSNFNHFQIERLLNKPGLKYKPVTNQVECHPYLTQEKLIQYCH 229

  Fly   237 YNGIIVTAFSPLGQPNR---KNHCPVYFFSEGMKRLVKKYKRSASQIVLRYLIDYGVVPIPKAAN 298
            ..||.|||:||||.|:|   |...|.......:|.:..|:|::.:|:::|:.|...|..|||:..
Human   230 SKGITVTAYSPLGSPDRPWAKPEDPSLLEDPKIKEIAAKHKKTTAQVLIRFHIQRNVTVIPKSMT 294

  Fly   299 PIHIKENLNIFDFKLDEADTRLLRGIKPKSRIVKYEIVKDHMFYPFE 345
            |.||.||:.:|||||.:.:...:.......|...::.......:||:
Human   295 PAHIVENIQVFDFKLSDEEMATILSFNRNWRAFDFKEFSHLEDFPFD 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 108/292 (37%)
Tas 50..324 CDD:223739 107/284 (38%)
AKR1B15NP_001074007.2 ARA1 56..325 CDD:223729 103/278 (37%)
Tas 57..317 CDD:223739 103/269 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158433
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.