DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and akr1b1.1

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001002048.1 Gene:akr1b1.1 / 415138 ZFINID:ZDB-GENE-040625-7 Length:315 Species:Danio rerio


Alignment Length:309 Identity:119/309 - (38%)
Similarity:178/309 - (57%) Gaps:8/309 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VRLSSGHEMPVLGFGTYKLRGYQCSAAVHCAIETGFRHFDTAYYYENEKEIGEALRTQIKMGNIS 105
            |.|::|.:||::|.||::....:.:.||..||.:|:||.|.|:.||||.|:|:.:...|..|.:.
Zfish     4 VTLNNGAKMPIVGLGTWRSPPGEVTEAVKSAILSGYRHIDGAHVYENENEVGDGICAMINQGVVK 68

  Fly   106 RENIFLTTKLWNTHHDPRDVRRICEKQLELLGFSYIDLYLMHFPVGYKYVCDEILMPMSGD-ELQ 169
            ||::|:.:|||.|.|:...||..|||.|..|...|:||||||||:|.|...|  |.|:..| .:.
Zfish    69 REDLFIVSKLWCTFHEKHLVRGACEKTLSDLKLDYVDLYLMHFPMGTKPGKD--LFPLDKDGHVI 131

  Fly   170 TVEIDYLDTWRAMENLVKLGMVRSIGLSNFNMEQIQRIIQCS--SSKPVVNQVEIWPGFLQKDLV 232
            ....::|:||.|||.||..|:|::||:||||.:||:.|:...  ..||..||:|..|...|:.|:
Zfish   132 PDNSNFLETWEAMEELVDAGLVKAIGISNFNRDQIEAILNKPGLKYKPANNQIECHPYLTQEKLI 196

  Fly   233 DYCRYNGIIVTAFSPLGQPNR---KNHCPVYFFSEGMKRLVKKYKRSASQIVLRYLIDYGVVPIP 294
            :||:..||.|||:||||.|||   :...|.......:|.:..|:.::.:|:::.:.|...||.||
Zfish   197 NYCQSKGITVTAYSPLGSPNRPWAQADEPSLLEDPKIKAIADKHGKTTAQVLIHFHIQRNVVVIP 261

  Fly   295 KAANPIHIKENLNIFDFKLDEADTRLLRGIKPKSRIVKYEIVKDHMFYP 343
            |:..|..||||..:|||:|.:.:...:.......|....|....|..:|
Zfish   262 KSVTPSRIKENFEVFDFELSKEEMNTILSFNRNFRAFGLEWASKHKDFP 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 116/296 (39%)
Tas 50..324 CDD:223739 111/279 (40%)
akr1b1.1NP_001002048.1 ARA1 1..296 CDD:223729 115/293 (39%)
Tas 1..288 CDD:223739 115/285 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.