DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and CG3397

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_650140.1 Gene:CG3397 / 41454 FlyBaseID:FBgn0037975 Length:342 Species:Drosophila melanogaster


Alignment Length:315 Identity:64/315 - (20%)
Similarity:128/315 - (40%) Gaps:90/315 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 AIETGFRHFDTAYYY---ENEKEIGEALRTQIKMGNISRENIFLTTKLWNTHHDPRDV------- 125
            ||.:|..:.|||.:|   ::|:.:|:||:      ::.||..::.||:.....||.::       
  Fly    64 AIRSGINYIDTAPFYGQGKSEELLGQALK------DVPREAYYIATKVARYELDPNNMFDYTAAK 122

  Fly   126 -RRICEKQLELLGFSYIDLYLMHFPVGYKYVCDEILMPMSGDELQTVEIDYLDTWRAMENLVKLG 189
             |...::.||||....:|:..:|                ..|...::::...:|...:|..|:.|
  Fly   123 ARESVKRSLELLQLDRVDVLQVH----------------DVDAAPSLDMVLNETIPVLEEYVQAG 171

  Fly   190 MVRSIGLSNFNMEQIQRIIQCSSSKPVVNQVEIWPGFLQKDLVDYCRYN---------------- 238
            ..|.||::.::::.::   :|:         |...|.:|. :::|.||.                
  Fly   172 KARFIGVTAYDVDVLK---ECA---------ERGKGRIQV-VLNYARYTLLDNTLLRHMKAFQEM 223

  Fly   239 --GIIVTAFSPLGQPNRKNHCPVYFFSEGMKRLVKKYKRSASQIVLRYLIDYGVVPIPKAANPIH 301
              |::..|...||.  ..|..| ..:..|...|:...||.| :|..:..::.|.:.:        
  Fly   224 GVGVVCAAAHSLGL--LSNAGP-QSWHPGSPELLAVGKRGA-EICQKRNVELGKLAM-------- 276

  Fly   302 IKENLNIFDFKLDEADTRLLRGIKPKSRIVK------YEIVKDHMFYPFELLKEN 350
                  .:..:||.|.|.|: || |..::::      ::.:..|.....:.|:||
  Fly   277 ------YYTMQLDGAATFLI-GI-PNRKLLRINLDAIFDGLTSHEQEVLQYLREN 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 60/289 (21%)
Tas 50..324 CDD:223739 57/281 (20%)
CG3397NP_650140.1 Tas 22..304 CDD:223739 60/294 (20%)
Aldo_ket_red 24..322 CDD:294321 62/312 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468233
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.