DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and CG10638

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster


Alignment Length:313 Identity:154/313 - (49%)
Similarity:211/313 - (67%) Gaps:3/313 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 MAPKVRLSSGHEMPVLGFGTYKLRGYQCSAAVHCAIETGFRHFDTAYYYENEKEIGEALRTQIKM 101
            :||.|:|::|:|||:||.|||..:..:..|||..||:.|:||.||||:|:||.|:|:|:|.:|..
  Fly     3 LAPTVKLNNGYEMPILGLGTYNSKDNEGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIAE 67

  Fly   102 GNISRENIFLTTKLWNTHHDPRDVRRICEKQLELLGFSYIDLYLMHFPVGYKYVCDEILMPMSGD 166
            |.:.||:|||.|||||..|||..|..||.|||...|..||||||||.|||||||.|..|:|.:.|
  Fly    68 GVVKREDIFLVTKLWNIFHDPERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKNED 132

  Fly   167 E-LQTVEIDYLDTWRAMENLVKLGMVRSIGLSNFNMEQIQRIIQCSSSKPVVNQVEIWPGFLQKD 230
            : ||..::|||||::|||.|||||:|||||:||||.||:.|::.....|||.||||..|...||.
  Fly   133 DVLQLSDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVLANCEIKPVTNQVECSPALNQKA 197

  Fly   231 LVDYCRYNGIIVTAFSPLGQPNRKNHCPVYFFSEGMKRLVKKYKRSASQIVLRYLIDYGVVPIPK 295
            |..:|:.|.:.:|.::|||:|......|.:.:|..:..:.|||.::..|||||||:..||:||||
  Fly   198 LTAFCKKNDVTLTGYTPLGKPKPDIQKPDFIYSPEVAVIAKKYGKTTPQIVLRYLVGLGVIPIPK 262

  Fly   296 AANPIHIKENLNIFDFKLDEADTRLLRGIKPKSRIVKYEIVK--DHMFYPFEL 346
            ::|...|.||.:||||:|...:..:|.|.....|:|...::|  :|.:|||.:
  Fly   263 SSNTNRISENFDIFDFELTAEEMAVLDGYHTGERVVPLNLIKGLNHKYYPFSI 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 148/295 (50%)
Tas 50..324 CDD:223739 139/274 (51%)
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 148/296 (50%)
Tas 5..297 CDD:223739 146/291 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472954
Domainoid 1 1.000 211 1.000 Domainoid score I1629
eggNOG 1 0.900 - - E1_COG0656
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 209 1.000 Inparanoid score I815
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm1169
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - P PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
1110.800

Return to query results.
Submit another query.