DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and CG12766

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster


Alignment Length:304 Identity:134/304 - (44%)
Similarity:192/304 - (63%) Gaps:1/304 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SSGHEMPVLGFGTYKLRGYQCSAAVHCAIETGFRHFDTAYYYENEKEIGEALRTQIKMGNISREN 108
            :.|..:..:|.||:......|..||..||:.|:||.||||:|.||.|:|.|:|.:|..|.|.||:
  Fly    12 NDGTHIQGIGLGTFASTEGDCERAVLHAIDVGYRHIDTAYFYGNEAEVGAAVRKKIAEGVIKRED 76

  Fly   109 IFLTTKLWNTHHDPRDVRRICEKQLELLGFSYIDLYLMHFPVGYKYVCDEILMPMSGD-ELQTVE 172
            ||:|||||...|:|..|...|.|.|:.:|..|:||||:|:|..|||..|..|:|...: |::.|:
  Fly    77 IFITTKLWCNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDNELIPKDANGEVELVD 141

  Fly   173 IDYLDTWRAMENLVKLGMVRSIGLSNFNMEQIQRIIQCSSSKPVVNQVEIWPGFLQKDLVDYCRY 237
            |||||||.|||.||.||:.:|||:||||.||:.|::.....||:.||:|:.|...||.|:..|:.
  Fly   142 IDYLDTWGAMEKLVDLGLTKSIGVSNFNEEQLTRLLANCKIKPIHNQIEVHPALDQKKLIALCKK 206

  Fly   238 NGIIVTAFSPLGQPNRKNHCPVYFFSEGMKRLVKKYKRSASQIVLRYLIDYGVVPIPKAANPIHI 302
            |||:||||||||:.|.:...|.:.:...::.:..||.:|.:|:|:||:|:.|.:|:||::||..|
  Fly   207 NGILVTAFSPLGRHNAELRTPTFMYDGKVQAIADKYNKSIAQVVIRYVIELGTIPLPKSSNPKRI 271

  Fly   303 KENLNIFDFKLDEADTRLLRGIKPKSRIVKYEIVKDHMFYPFEL 346
            :||.|:||||||..|..:|.......|:..........:|||.:
  Fly   272 EENFNVFDFKLDAEDHAILDSYHNGERVAHARQAIKSKYYPFNV 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 131/288 (45%)
Tas 50..324 CDD:223739 129/274 (47%)
CG12766NP_647839.1 ARA1 5..298 CDD:223729 130/285 (46%)
Tas 12..299 CDD:223739 130/286 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472958
Domainoid 1 1.000 211 1.000 Domainoid score I1629
eggNOG 1 0.900 - - E1_COG0656
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 209 1.000 Inparanoid score I815
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm1169
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - P PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
1110.800

Return to query results.
Submit another query.