DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and Akr1c15

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001103370.1 Gene:Akr1c15 / 361267 RGDID:1307514 Length:324 Species:Rattus norvegicus


Alignment Length:322 Identity:112/322 - (34%)
Similarity:173/322 - (53%) Gaps:28/322 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VRLSSGHEMPVLGFGTY---KLRGYQCSAAVHCAIETGFRHFDTAYYYENEKEIGEALRTQIKMG 102
            |:|:.|:.||||||||:   ::...:.:.|...||:.||||.|.||:|:||:|:|:|||.::..|
  Rat     9 VKLNDGNLMPVLGFGTFASKEIPKSKAAEATKVAIDVGFRHIDAAYFYQNEEEVGQALRDKMADG 73

  Fly   103 NISRENIFLTTKLWNTHHDPRDVRRICEKQLELLGFSYIDLYLMHFPVGYKYVCDEILMPMSGDE 167
            .:.||::|.|||:|.|...|..||:..|:.|:.||..|:||.::|.|:..|          .|:|
  Rat    74 TVKREDLFYTTKIWITFLRPELVRQCLERSLKKLGLDYVDLCIIHIPIAMK----------PGEE 128

  Fly   168 LQTVE---------IDYLDTWRAMENLVKLGMVRSIGLSNFNMEQIQRIIQCS--SSKPVVNQVE 221
            |...:         :|..|||.|:|.....|:.:|||:||||.:|::.|:...  ..||..||||
  Rat   129 LLPKDANGKFIFDTVDIRDTWEALEKCKDAGLSKSIGVSNFNHKQLELILNKPRLKYKPTCNQVE 193

  Fly   222 IWPGFLQKDLVDYCRYNGIIVTAFSPLGQPNR----KNHCPVYFFSEGMKRLVKKYKRSASQIVL 282
            ..|...|..|:::|:...|::.|:|.||....    .:..|.......:..:.||:.::..|:.|
  Rat   194 CHPYLNQSKLLEFCKSKDIVLVAYSALGSHRDSSWVSSDSPYLLEDPVLMTIAKKHNQTPGQVAL 258

  Fly   283 RYLIDYGVVPIPKAANPIHIKENLNIFDFKLDEADTRLLRGIKPKSRIVKYEIVKDHMFYPF 344
            ||.:..|||.:.|:.|...||||..:|||:|...|.:.:..:....|..:.....||..|||
  Rat   259 RYQLQRGVVVLAKSFNEKRIKENFQVFDFELTPEDMKTIDSLNRNFRYSQMAFALDHPDYPF 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 107/308 (35%)
Tas 50..324 CDD:223739 102/291 (35%)
Akr1c15NP_001103370.1 ARA1 9..306 CDD:223729 106/306 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm8954
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.