DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and Akr1e2

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001008343.1 Gene:Akr1e2 / 307091 RGDID:1309599 Length:301 Species:Rattus norvegicus


Alignment Length:303 Identity:114/303 - (37%)
Similarity:182/303 - (60%) Gaps:8/303 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 HEMPVLGFGTYKLRGYQCSAAVHCAIETGFRHFDTAYYYENEKEIGEALRTQIKMGNISRENIFL 111
            |::|.:|.||:|....:.:.||..||..|:||||.||.|.||.|:|..::.:||.|.:.|:.:|:
  Rat     2 HQIPTVGLGTWKASPGEVTDAVKVAINLGYRHFDCAYLYHNESEVGMGIKEKIKEGVVKRDELFI 66

  Fly   112 TTKLWNTHHDPRDVRRICEKQLELLGFSYIDLYLMHFPVGYKYVCDEILMPMSGDELQTVEIDYL 176
            .:|||.|:|....|:..|...||.|...|:||||:|:|:|:|....:|.:..||..:.: ...:|
  Rat    67 VSKLWCTYHKQSLVKTACINTLEALNLDYLDLYLIHWPMGFKPGDKDIPLDRSGKVIPS-HTSFL 130

  Fly   177 DTWRAMENLVKLGMVRSIGLSNFNMEQIQRIIQCSS--SKPVVNQVEIWPGFLQKDLVDYCRYNG 239
            |||.|||:||..|:|::||:||||.||:.|::....  .||:.||:|..|...||.|:|:|....
  Rat   131 DTWEAMEDLVIEGLVKNIGVSNFNHEQLDRLLNKPGLRIKPITNQIECHPYLNQKSLIDFCHGRN 195

  Fly   240 IIVTAFSPLGQPNRKNHCPVYFFSE-GMKRLVKKYKRSASQIVLRYLIDYGVVPIPKAANPIHIK 303
            :.|||:.|||    .:...|:...: .::::.||:.:|.:||::|:.|...::.|||:.||..|:
  Rat   196 VSVTAYRPLG----GSRDGVHLMDDIVIRKIAKKHGKSPAQILIRFQIQRNLIVIPKSVNPSRIR 256

  Fly   304 ENLNIFDFKLDEADTRLLRGIKPKSRIVKYEIVKDHMFYPFEL 346
            ||:.:|||:|.|.|...|..:....|:..:...::|..|||.:
  Rat   257 ENIQVFDFELTEKDMEELLSLDKNLRLATFPSTENHKDYPFHI 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 110/287 (38%)
Tas 50..324 CDD:223739 108/276 (39%)
Akr1e2NP_001008343.1 Tas 4..287 CDD:223739 109/287 (38%)
ARA1 4..282 CDD:223729 108/282 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.