DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and Akr1b10

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001013102.1 Gene:Akr1b10 / 296972 RGDID:1308277 Length:316 Species:Rattus norvegicus


Alignment Length:288 Identity:118/288 - (40%)
Similarity:180/288 - (62%) Gaps:10/288 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 MAPKVRLSSGHEMPVLGFGTYKLRGYQCSAAVHCAIETGFRHFDTAYYYENEKEIGEALRTQIKM 101
            ||..|:||:..:||::|.||:|....:...||..||:.|:||||.||.|:||.|:|||::.:||.
  Rat     1 MAAFVKLSTKAKMPIVGLGTWKSPPDKVKEAVKAAIDAGYRHFDCAYVYQNESEVGEAIQEKIKE 65

  Fly   102 GNISRENIFLTTKLWNTHHDPRDVRRICEKQLELLGFSYIDLYLMHFPVGYKYVCDEILMPM--S 164
            ..:.||::|:.:|||.|..:...|::..:|.|..|...|:||||:|:|.|::  ...:.:|.  .
  Rat    66 KAVRREDLFIVSKLWPTFFEKSLVKKAFQKTLLDLKLDYLDLYLIHWPQGFQ--SGNVFLPTDDK 128

  Fly   165 GDELQTVEIDYLDTWRAMENLVKLGMVRSIGLSNFNMEQIQRIIQCS--SSKPVVNQVEIWPGFL 227
            |:.| |.:..:||.|..||.||..|:|:::|:||||..||:|::...  ..|||.||||..|...
  Rat   129 GNVL-TSKYTFLDAWEGMEELVDQGLVKALGVSNFNHFQIERLLNKPGLKHKPVTNQVECHPYLT 192

  Fly   228 QKDLVDYCRYNGIIVTAFSPLGQPNR---KNHCPVYFFSEGMKRLVKKYKRSASQIVLRYLIDYG 289
            |:.|:.||...||:|||:||||.|:|   |...||......:|.:..|:|::|:|:::|:.|:..
  Rat   193 QEKLIQYCHSKGIVVTAYSPLGSPDRPSAKPEDPVLLEIPKIKEIASKHKKTAAQVLIRFHIERN 257

  Fly   290 VVPIPKAANPIHIKENLNIFDFKLDEAD 317
            |..|||:..|..|:||:.:|||:|.|.|
  Rat   258 VAVIPKSVTPSRIQENIQVFDFQLSEED 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 118/288 (41%)
Tas 50..324 CDD:223739 112/275 (41%)
Akr1b10NP_001013102.1 AKR_AKR1B1-19 10..316 CDD:381333 113/279 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.