DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and Akr1b8

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_775159.1 Gene:Akr1b8 / 286921 RGDID:708475 Length:316 Species:Rattus norvegicus


Alignment Length:289 Identity:114/289 - (39%)
Similarity:174/289 - (60%) Gaps:12/289 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 MAPKVRLSSGHEMPVLGFGTYKLRGYQCSAAVHCAIETGFRHFDTAYYYENEKEIGEALRTQIKM 101
            ||..|.||:..:||::|.||:|....|...||..||:.|:||.|.||.|.||.|:|||::.:||.
  Rat     1 MATFVELSTKAKMPIVGLGTWKSMPNQVKEAVKAAIDAGYRHIDCAYAYCNENEVGEAIQEKIKE 65

  Fly   102 GNISRENIFLTTKLWNTHHDPRDVRRICEKQLELLGFSYIDLYLMHFPVGYKYVCDEILMPMSGD 166
            ..:.||::|:.:|||.|..:.:.::...:|.|..|...|:||||:|:|.|::  ..:.|.|.  |
  Rat    66 KAVRREDLFIVSKLWPTCFEKKLLKEAFQKTLTDLKLDYLDLYLIHWPQGFQ--AGKELFPK--D 126

  Fly   167 ELQTV---EIDYLDTWRAMENLVKLGMVRSIGLSNFNMEQIQRIIQCS--SSKPVVNQVEIWPGF 226
            |...|   :..:|:.|..||.||..|:|:::|:||||..||:|::...  ..|||.||||..|..
  Rat   127 EQGNVLPSKTTFLEAWEGMEELVDQGLVKALGVSNFNHFQIERLLNKPGLKHKPVTNQVECHPYL 191

  Fly   227 LQKDLVDYCRYNGIIVTAFSPLGQPNR---KNHCPVYFFSEGMKRLVKKYKRSASQIVLRYLIDY 288
            .|:.|:.||...||:|||:||||.|:|   |...|.......:|.:..|:|::.:|:::|:.|..
  Rat   192 TQEKLIQYCHSKGIVVTAYSPLGSPDRPRAKPDDPSLLQDPKIKEIAAKHKKTTAQVLIRFHIQR 256

  Fly   289 GVVPIPKAANPIHIKENLNIFDFKLDEAD 317
            .||.|||:..|..|:||:.:|||:|.:.:
  Rat   257 NVVVIPKSVTPARIQENIQVFDFQLSDQE 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 114/289 (39%)
Tas 50..324 CDD:223739 108/276 (39%)
Akr1b8NP_775159.1 ARA1 1..297 CDD:223729 114/289 (39%)
Tas 16..289 CDD:223739 107/274 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.