DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and SPAC26F1.07

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_594888.1 Gene:SPAC26F1.07 / 2542088 PomBaseID:SPAC26F1.07 Length:321 Species:Schizosaccharomyces pombe


Alignment Length:292 Identity:99/292 - (33%)
Similarity:155/292 - (53%) Gaps:15/292 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LSSGHEMPVLGFGTYKLRGYQCSAAVHCAIETGFRHFDTAYYYENEKEIGEALRTQIKMGNISRE 107
            |:.|.::|.||.||::....|...||..|::.|:||.|.|..|.||.|:|:.    ||...:.|:
pombe    18 LADGSKIPGLGLGTWRSEPNQTKNAVKTALQYGYRHIDAAAIYGNEDEVGDG----IKESGVPRK 78

  Fly   108 NIFLTTKLWNTHHDPRDVRRICEKQLELLGFSYIDLYLMHFPVGYKYVCDEILMPMSGD---ELQ 169
            :|::|:|||...|.|..|.:..||.|:.|...|:|.||:|:||.:|...|:......|:   |..
pombe    79 DIWVTSKLWCNAHAPEAVPKALEKTLKDLKLDYLDEYLIHWPVSFKTGEDKFPKDKDGNLIYEKN 143

  Fly   170 TVEIDYLDTWRAMENLVKLGMVRSIGLSNFNMEQIQRIIQCSSSKPVVNQVEIWPGFLQKDLVDY 234
            .:|    :||:|||.|::.|.||.|||||||...::||::.:..||.|:|:|:.|...|.:.|:.
pombe   144 PIE----ETWKAMEKLLETGKVRHIGLSNFNDTNLERILKVAKVKPAVHQMELHPFLPQTEFVEK 204

  Fly   235 CRYNGIIVTAFSPLGQPNR--KNHCPVYFFSEGMKRLVKKYKR--SASQIVLRYLIDYGVVPIPK 295
            .:..||.|||:||.|..|.  ::..|.....|.::::.|....  :.:.|.:.:.|..|...|||
pombe   205 HKKLGIHVTAYSPFGNQNTIYESKIPKLIEHETIQKIAKSKGEGVTGATIAVSWAITRGTSVIPK 269

  Fly   296 AANPIHIKENLNIFDFKLDEADTRLLRGIKPK 327
            :.|...||.|........::.|.....||:.:
pombe   270 SVNEQRIKSNFKYIPLTKEDMDEINSIGIRAR 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 99/292 (34%)
Tas 50..324 CDD:223739 95/280 (34%)
SPAC26F1.07NP_594888.1 ARA1 15..302 CDD:223729 99/292 (34%)
Tas 21..303 CDD:223739 98/289 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm9270
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.