DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and Gclm

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001262845.1 Gene:Gclm / 248194 FlyBaseID:FBgn0046114 Length:285 Species:Drosophila melanogaster


Alignment Length:200 Identity:37/200 - (18%)
Similarity:75/200 - (37%) Gaps:37/200 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 HFD-TAYYYENEKEIGE----------ALRTQIKMGNISRENIFLTTKLWNTHHDPRDVRRICEK 131
            |.| ||.....||||.|          .|.|::...  .|..|.:..|::...|....|.:..|:
  Fly    42 HTDSTAERVVVEKEIDELHGRVQRATQELTTRLTEN--GRNEISIGAKIFLNRHSTESVNQAVEE 104

  Fly   132 QLELLGFSYIDLYLMHF---------PVG-YKYVCDE---ILMPMSGDELQTVE--IDYLDTWRA 181
            .|.:|..:::|..::.:         ||. .|..|.|   :....:..:....|  .:..:.::.
  Fly   105 LLHILSVTHVDNVVLAYHPNAVATATPVATTKPPCSEDSNVSRATNWSQRNGKEGVAELKELYKT 169

  Fly   182 MENLVKLGMVRSIGLSNFNMEQIQRIIQCSSSKPVVNQVE-----IWPGFLQKDLVDYCRYNGII 241
            :|.......:..:|:::.:...::.:...:...|.:.||.     :.|..||    ::|..:.|.
  Fly   170 LEQYALKQQITQLGIADLDAAALEELHNSAQVVPTIAQVNLSTCCVVPPELQ----EFCTAHDIQ 230

  Fly   242 VTAFS 246
            :...|
  Fly   231 LNTHS 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 36/199 (18%)
Tas 50..324 CDD:223739 36/199 (18%)
GclmNP_001262845.1 Aldo_ket_red <79..>238 CDD:294321 25/160 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.