DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and AKR1B1

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001619.1 Gene:AKR1B1 / 231 HGNCID:381 Length:316 Species:Homo sapiens


Alignment Length:318 Identity:119/318 - (37%)
Similarity:185/318 - (58%) Gaps:16/318 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 MAPKVRLSSGHEMPVLGFGTYKLRGYQCSAAVHCAIETGFRHFDTAYYYENEKEIGEALRTQIKM 101
            ||.::.|::|.:||:||.||:|....|.:.||..||:.|:||.|.|:.|:||.|:|.|::.:::.
Human     1 MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLRE 65

  Fly   102 GNISRENIFLTTKLWNTHHDPRDVRRICEKQLELLGFSYIDLYLMHFPVGYK-----YVCDEILM 161
            ..:.||.:|:.:|||.|:|:...|:..|:|.|..|...|:||||:|:|.|:|     :..||   
Human    66 QVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDE--- 127

  Fly   162 PMSGDELQTVEIDYLDTWRAMENLVKLGMVRSIGLSNFNMEQIQRIIQCS--SSKPVVNQVEIWP 224
              ||:.:.: :.:.||||.|||.||..|:|::||:||||..|::.|:...  ..||.|||:|..|
Human   128 --SGNVVPS-DTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHP 189

  Fly   225 GFLQKDLVDYCRYNGIIVTAFSPLGQPNR---KNHCPVYFFSEGMKRLVKKYKRSASQIVLRYLI 286
            ...|:.|:.||:..||:|||:||||.|:|   |...|.......:|.:..|:.::.:|:::|:.:
Human   190 YLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPM 254

  Fly   287 DYGVVPIPKAANPIHIKENLNIFDFKLDEADTRLLRGIKPKSRIVKYEIVKDHMFYPF 344
            ...:|.|||:..|..|.||..:|||:|...|...|.......|:........|..|||
Human   255 QRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPF 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 115/304 (38%)
Tas 50..324 CDD:223739 109/283 (39%)
AKR1B1NP_001619.1 AKR_AKR1B1-19 10..316 CDD:381333 116/309 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.