DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and C56G3.2

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001367459.1 Gene:C56G3.2 / 183870 WormBaseID:WBGene00016985 Length:131 Species:Caenorhabditis elegans


Alignment Length:90 Identity:26/90 - (28%)
Similarity:41/90 - (45%) Gaps:11/90 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 WNTHHDPRDVRRICEKQLELLGFSYIDLYLMHFPVGYKYVCDEILMPMSGDELQTVEIDYLDTWR 180
            |.....|..:.......|:.|...|:||||.|.|..:           |.|..|.:|....|.||
 Worm    53 WTNELAPGRLEGALRDSLKKLHLEYVDLYLAHMPTAF-----------SDDMSQKIESSVEDIWR 106

  Fly   181 AMENLVKLGMVRSIGLSNFNMEQIQ 205
            ..:.:.|.|:.:::|:||:|.:||:
 Worm   107 QFDAVYKAGLAKAVGVSNWNNDQIR 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 26/90 (29%)
Tas 50..324 CDD:223739 26/90 (29%)
C56G3.2NP_001367459.1 AKR_SF <51..>131 CDD:412396 25/88 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166091
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.