DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and C07D8.5

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_509243.1 Gene:C07D8.5 / 182366 WormBaseID:WBGene00015564 Length:134 Species:Caenorhabditis elegans


Alignment Length:120 Identity:36/120 - (30%)
Similarity:57/120 - (47%) Gaps:26/120 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GNQNTQCGEKA-----------------LLMAPKVR---------LSSGHEMPVLGFGTYKLRGY 62
            ||.|.|.|..:                 :|:...::         ||:.|.||.:|.||::....
 Worm     5 GNINDQAGRSSNSDGNASDDGHPPALTPILLKSYLKNSDAKSHLTLSNAHSMPAVGLGTWQSNAE 69

  Fly    63 QCSAAVHCAIETGFRHFDTAYYYENEKEIGEALRTQIKMGNISRENIFLTTKLWN 117
            ...:||..|::.|:...|||..|.||:.||.|::..|..|.:.||::|:|||:.|
 Worm    70 DVISAVKAAVKNGYSLIDTASGYNNEEFIGTAIKEVIAEGVVKREDLFITTKVPN 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 30/90 (33%)
Tas 50..324 CDD:223739 26/68 (38%)
C07D8.5NP_509243.1 AKR_SF 45..>126 CDD:382030 30/80 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166101
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.