DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and Akr1b8

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_032038.1 Gene:Akr1b8 / 14187 MGIID:107673 Length:316 Species:Mus musculus


Alignment Length:295 Identity:114/295 - (38%)
Similarity:172/295 - (58%) Gaps:24/295 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 MAPKVRLSSGHEMPVLGFGTYKLRGYQCSAAVHCAIETGFRHFDTAYYYENEKEIGEALRTQIKM 101
            ||..|.||:..:||::|.||:|....|...||..||:.|:||.|.||.|.||.|:|||::.:||.
Mouse     1 MATFVELSTKAKMPIVGLGTWKSPPNQVKEAVKAAIDAGYRHIDCAYAYCNENEVGEAIQEKIKE 65

  Fly   102 GNISRENIFLTTKLWNTHHDPRDVRRICEKQLELLGFSYIDLYLMHFPVGYKYVCDEILMPMSGD 166
            ..:.||::|:.:|||.|..:.:.::...:|.|..|...|:||||:|:|.|        |.|  |.
Mouse    66 KAVQREDLFIVSKLWPTCFEKKLLKEAFQKTLTDLKLDYLDLYLIHWPQG--------LQP--GK 120

  Fly   167 EL---------QTVEIDYLDTWRAMENLVKLGMVRSIGLSNFNMEQIQRIIQCS--SSKPVVNQV 220
            ||         .|.:..:|:.|..||.||..|:|:::|:||||..||:|::...  ..|||.|||
Mouse   121 ELFPKDDQGRILTSKTTFLEAWEGMEELVDQGLVKALGVSNFNHFQIERLLNKPGLKHKPVTNQV 185

  Fly   221 EIWPGFLQKDLVDYCRYNGIIVTAFSPLGQPNR---KNHCPVYFFSEGMKRLVKKYKRSASQIVL 282
            |..|...|:.|:.||...||.|||:||||.|:|   |...|.......:|.:..|::::::|:::
Mouse   186 ECHPYLTQEKLIQYCHSKGISVTAYSPLGSPDRPSAKPEDPSLLEDPKIKEIAAKHEKTSAQVLI 250

  Fly   283 RYLIDYGVVPIPKAANPIHIKENLNIFDFKLDEAD 317
            |:.|...||.|||:..|..|:||:.:|||:|.:.:
Mouse   251 RFHIQRNVVVIPKSVTPSRIQENIQVFDFQLSDEE 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 114/295 (39%)
Tas 50..324 CDD:223739 108/282 (38%)
Akr1b8NP_032038.1 ARA1 1..297 CDD:223729 114/295 (39%)
Tas 16..289 CDD:223739 107/280 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.