DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and Akr1b7

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_033861.2 Gene:Akr1b7 / 11997 MGIID:101918 Length:316 Species:Mus musculus


Alignment Length:314 Identity:119/314 - (37%)
Similarity:180/314 - (57%) Gaps:8/314 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 MAPKVRLSSGHEMPVLGFGTYKLRGYQCSAAVHCAIETGFRHFDTAYYYENEKEIGEALRTQIKM 101
            ||..|.||:..:||::|.||:|....|...||..||:.|:||.|.||.|.||.|:|||::.:||.
Mouse     1 MATFVELSTKAKMPLVGLGTWKSSPGQVKEAVKAAIDAGYRHIDCAYVYHNENEVGEAIQEKIKE 65

  Fly   102 GNISRENIFLTTKLWNTHHDPRDVRRICEKQLELLGFSYIDLYLMHFPVGYKYVCDEILMPMSG- 165
            ..:.||::|:.:|||.|..:...|::..:..|..|...|:||||:|:|.|::  ....|:|... 
Mouse    66 NAVKREDLFIVSKLWATFFEKSLVKKAFQNTLSDLKLDYLDLYLVHWPQGFQ--AGNALLPKDNK 128

  Fly   166 DELQTVEIDYLDTWRAMENLVKLGMVRSIGLSNFNMEQIQRIIQCS--SSKPVVNQVEIWPGFLQ 228
            .::...:..:||.|.|||.||..|:|:::|:||||..||:|::...  ..|||.||:|..|...|
Mouse   129 GKVLLSKSTFLDAWEAMEELVDQGLVKALGISNFNHFQIERLLNKPGLKHKPVTNQIESHPYLTQ 193

  Fly   229 KDLVDYCRYNGIIVTAFSPLGQPNR---KNHCPVYFFSEGMKRLVKKYKRSASQIVLRYLIDYGV 290
            :.|:.||:..||.|||:||||.|:|   |...||......:|.:..|:|::.:|:::|:.:...|
Mouse   194 EKLIQYCQSKGIAVTAYSPLGSPDRPYAKPEDPVVMEIPKIKEIAAKHKKTVAQVLIRFHVQRNV 258

  Fly   291 VPIPKAANPIHIKENLNIFDFKLDEADTRLLRGIKPKSRIVKYEIVKDHMFYPF 344
            |.|||:..|..|:|||.:|||:|.|.|...:.......|.......:....|||
Mouse   259 VVIPKSVTPSRIQENLQVFDFQLSEEDMAAILSFNRNWRACDLLDARTEEDYPF 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 116/300 (39%)
Tas 50..324 CDD:223739 109/279 (39%)
Akr1b7NP_033861.2 AKR_AKR1B1-19 10..316 CDD:381333 114/305 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S875
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.680

Return to query results.
Submit another query.