DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and Akr1c20

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001298061.1 Gene:Akr1c20 / 116852 MGIID:2151104 Length:323 Species:Mus musculus


Alignment Length:318 Identity:120/318 - (37%)
Similarity:176/318 - (55%) Gaps:20/318 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VRLSSGHEMPVLGFGT---YKLRGYQCSAAVHCAIETGFRHFDTAYYYENEKEIGEALRTQIKMG 102
            |.|:.||.:|:|||||   .::...:.:.|...||:.||||.|.|..|:||||:|.|:|::|..|
Mouse     8 VLLNDGHFIPILGFGTSAPQEVPRSKATEATKIAIDAGFRHIDCAAVYQNEKEVGLAIRSKIVDG 72

  Fly   103 NISRENIFLTTKLWNTHHDPRDVRRICEKQLELLGFSYIDLYLMHFPVGYK-----YVCDEILMP 162
            .:.||:||.|:|:|.|.|.|..|:...|:.|:.|...|:||||:|||:..|     :..||    
Mouse    73 TVKREDIFCTSKVWQTFHRPELVQVCLEQSLKQLQLDYVDLYLIHFPIAMKPGENYFPKDE---- 133

  Fly   163 MSGDELQTVEIDYLDTWRAMENLVKLGMVRSIGLSNFNMEQIQRIIQCS--SSKPVVNQVEIWPG 225
             :|..:... :|..|||.|||.....|:.:|||:.|||..|:::|:...  ..|||.||||..|.
Mouse   134 -NGKFIYDA-VDICDTWEAMEKCKDAGLAKSIGVCNFNRRQLEKILSKPGLKYKPVCNQVECHPY 196

  Fly   226 FLQKDLVDYCRYNGIIVTAFSPLGQPNRK----NHCPVYFFSEGMKRLVKKYKRSASQIVLRYLI 286
            ..|:.|:|:||...|::.|.|.||....|    ...||......:..:.|||.|:.:.|.|||.:
Mouse   197 LNQRKLLDFCRSKDIVLVAHSALGSNRDKEWVDKSFPVLLDDPVLGSMAKKYNRTPALIALRYQV 261

  Fly   287 DYGVVPIPKAANPIHIKENLNIFDFKLDEADTRLLRGIKPKSRIVKYEIVKDHMFYPF 344
            ..|||.:.|:.....||||:.:|:|:|...|.::|.|:....|.:...|.:||..:||
Mouse   262 QRGVVVLAKSFIEKRIKENMQVFEFQLTSVDMKVLDGLNKNIRYIGSSISEDHPDFPF 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 115/304 (38%)
Tas 50..324 CDD:223739 109/287 (38%)
Akr1c20NP_001298061.1 ARA1 5..317 CDD:223729 118/314 (38%)
Tas 16..297 CDD:223739 108/286 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.