DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and Akr1b7

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_038962847.1 Gene:Akr1b7 / 116463 RGDID:620257 Length:329 Species:Rattus norvegicus


Alignment Length:287 Identity:108/287 - (37%)
Similarity:164/287 - (57%) Gaps:6/287 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 QCSAAVHCAIETGFRHFDTAYYYENEKEIGEALRTQIKMGNISRENIFLTTKLWNTHHDPRDVRR 127
            |...||..||:.|:||||.||.|:||.|:|||::.:||...:.||::|:.:|||:|..:...::.
  Rat    40 QVKEAVKAAIDAGYRHFDCAYVYQNESEVGEAIQEKIKEKAVRREDLFIVSKLWSTFFEKSLMKE 104

  Fly   128 ICEKQLELLGFSYIDLYLMHFPVGYKYVCDEILMPMSGDELQTVEIDYLDTWRAMENLVKLGMVR 192
            ..:|.|..|...|:||||:|:|.|.: ...|.|...|..::...:..:||.|..||.||..|:|:
  Rat   105 AFQKTLSDLKLDYLDLYLIHWPQGLQ-AGKEFLPKDSQGKVLMSKSTFLDAWEGMEELVDQGLVK 168

  Fly   193 SIGLSNFNMEQIQRIIQCS--SSKPVVNQVEIWPGFLQKDLVDYCRYNGIIVTAFSPLGQPNR-- 253
            ::|:||||..||:|::...  ..|||.||||..|...|:.|:.||...||.|.|:||||.|:|  
  Rat   169 ALGVSNFNHFQIERLLNKPGLKHKPVTNQVECHPYLTQEKLIQYCHSKGIAVIAYSPLGSPDRPY 233

  Fly   254 -KNHCPVYFFSEGMKRLVKKYKRSASQIVLRYLIDYGVVPIPKAANPIHIKENLNIFDFKLDEAD 317
             |...||......:|.:..|:|::.:|:::|:.:...|..|||:....|||||:.:|||:|.|.|
  Rat   234 AKPEDPVVLEIPKIKEIAAKHKKTIAQVLIRFHVQRNVAVIPKSVTLSHIKENIQVFDFQLSEED 298

  Fly   318 TRLLRGIKPKSRIVKYEIVKDHMFYPF 344
            ...:..:....|.....:..|...:||
  Rat   299 MAAILSLNRNWRACGLFVTSDEEDFPF 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 105/273 (38%)
Tas 50..324 CDD:223739 104/265 (39%)
Akr1b7XP_038962847.1 AKR_SF 35..329 CDD:412396 108/287 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.