DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and AKR1C4

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001809.4 Gene:AKR1C4 / 1109 HGNCID:387 Length:323 Species:Homo sapiens


Alignment Length:323 Identity:128/323 - (39%)
Similarity:179/323 - (55%) Gaps:19/323 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 MAPK---VRLSSGHEMPVLGFGTYKLRGYQCSAAVH---CAIETGFRHFDTAYYYENEKEIGEAL 95
            |.||   |.|:.||.|||||||||.......:.||.   .|||.||||.|:||.|.||:::|.|:
Human     1 MDPKYQRVELNDGHFMPVLGFGTYAPPEVPRNRAVEVTKLAIEAGFRHIDSAYLYNNEEQVGLAI 65

  Fly    96 RTQIKMGNISRENIFLTTKLWNTHHDPRDVRRICEKQLELLGFSYIDLYLMHFPVGYKYVCDEIL 160
            |::|..|::.||:||.|:|||.|...|:.|:...|..|:.|...|:||||:|||:..|    ...
Human    66 RSKIADGSVKREDIFYTSKLWCTFFQPQMVQPALESSLKKLQLDYVDLYLLHFPMALK----PGE 126

  Fly   161 MPMSGDELQTVEIDYLD---TWRAMENLVKLGMVRSIGLSNFNMEQIQRIIQCS--SSKPVVNQV 220
            .|:..||...|..|.:|   ||..||.....|:.:|||:||||..|::.|:...  ..|||.|||
Human   127 TPLPKDENGKVIFDTVDLSATWEVMEKCKDAGLAKSIGVSNFNCRQLEMILNKPGLKYKPVCNQV 191

  Fly   221 EIWPGFLQKDLVDYCRYNGIIVTAFSPLGQPNRK----NHCPVYFFSEGMKRLVKKYKRSASQIV 281
            |..|...|..|:|:|:...|::.|.|.||....|    .:.||......:..|.||:|::.:.|.
Human   192 ECHPYLNQSKLLDFCKSKDIVLVAHSALGTQRHKLWVDPNSPVLLEDPVLCALAKKHKQTPALIA 256

  Fly   282 LRYLIDYGVVPIPKAANPIHIKENLNIFDFKLDEADTRLLRGIKPKSRIVKYEIVKDHMFYPF 344
            |||.:..|||.:.|:.|...|:||:.:|:|:|...|.::|.|:....|.|..:.:.||..|||
Human   257 LRYQLQRGVVVLAKSYNEQRIRENIQVFEFQLTSEDMKVLDGLNRNYRYVVMDFLMDHPDYPF 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 122/309 (39%)
Tas 50..324 CDD:223739 112/285 (39%)
AKR1C4NP_001809.4 AKR_AKR1C1-35 6..306 CDD:381334 119/303 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.