DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and AKR1A1

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001189342.1 Gene:AKR1A1 / 10327 HGNCID:380 Length:325 Species:Homo sapiens


Alignment Length:325 Identity:124/325 - (38%)
Similarity:177/325 - (54%) Gaps:20/325 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LMAPKVRLSSGHEMPVLGFGTYKLRGYQCSAAVHCAIETGFRHFDTAYYYENEKEIGEALRTQIK 100
            :.|..|.|.:|.:||::|.||:|....|..|||..|:..|:||.|.|..|.||.||||||:..:.
Human     1 MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEALKEDVG 65

  Fly   101 MGN-ISRENIFLTTKLWNTHHDPRDVRRICEKQLELLGFSYIDLYLMHFPVGYKYVCDEILMPMS 164
            .|. :.||.:|:|:|||||.|.|.||.....|.|..|...|:||||||:|  |.:...:...|.:
Human    66 PGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWP--YAFERGDNPFPKN 128

  Fly   165 GDELQTVEID---YLDTWRAMENLVKLGMVRSIGLSNFNMEQIQRIIQCSSSKPVVNQVEIWPGF 226
            .|  .|:..|   |.:||:|:|.||..|:|:::||||||..||..|:..:|.:|.|.|||..|..
Human   129 AD--GTICYDSTHYKETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRPAVLQVECHPYL 191

  Fly   227 LQKDLVDYCRYNGIIVTAFSPLGQPN---RKNHCPVYFFSEGMKRLVKKYKRSASQIVLRYLIDY 288
            .|.:|:.:|:..|:.|||:||||..:   |....||......:..|.:||.||.:||:||:.:..
Human   192 AQNELIAHCQARGLEVTAYSPLGSSDRAWRDPDEPVLLEEPVVLALAEKYGRSPAQILLRWQVQR 256

  Fly   289 GVVPIPKAANPIHIKENLNIFDFKLDEADTRLLRGIKPKSRIVKYEIVKD---------HMFYPF 344
            .|:.|||:..|..|.:|:.:|||.....:.:.|..:....|.:...:..|         |..|||
Human   257 KVICIPKSITPSRILQNIKVFDFTFSPEEMKQLNALNKNWRYIVPMLTVDGKRVPRDAGHPLYPF 321

  Fly   345  344
            Human   322  321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 119/301 (40%)
Tas 50..324 CDD:223739 113/280 (40%)
AKR1A1NP_001189342.1 ARA1 6..303 CDD:223729 118/300 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.690

Return to query results.
Submit another query.