DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and LOC101733893

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_031746807.1 Gene:LOC101733893 / 101733893 -ID:- Length:290 Species:Xenopus tropicalis


Alignment Length:280 Identity:107/280 - (38%)
Similarity:158/280 - (56%) Gaps:10/280 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PKVRLSSGHEMPVLGFGTYKLRGYQCSAA---VHCAIETGFRHFDTAYYYENEKEIGEALRTQIK 100
            |.|.|:.||:|||||||||....:..|.|   ...||:.|:||.|.|:.|.||.|:|.|::.:|.
 Frog     7 PCVELNDGHKMPVLGFGTYAPEKFPKSLAEEGTKVAIDVGYRHIDCAFIYGNEVEVGRAIKAKIA 71

  Fly   101 MGNISRENIFLTTKLWNTHHDPRDVRRICEKQLELLGFSYIDLYLMHFPVGYKYVCDEILMPMSG 165
            .|.:.||::|.|.|||:|.|.|..||...||.|..|...|:||:::|.||.:|...|.:.:..:|
 Frog    72 DGTVKREDVFYTGKLWSTFHTPERVRPALEKSLTDLQLDYMDLFIIHNPVEFKPGDDPLPLDENG 136

  Fly   166 DELQTVEIDYLDTWRAMENLVKLGMVRSIGLSNFNMEQIQRIIQCS--SSKPVVNQVEIWPGFLQ 228
            ..: ....|..|||:|:|.....|:|||||:||||.:|::.|:...  ..|||.||||......|
 Frog   137 KPI-FHNTDLRDTWKALEKCKDAGLVRSIGVSNFNHKQLELILNMPGLKYKPVCNQVECHIYLDQ 200

  Fly   229 KDLVDYCRYNGIIVTAFSPLGQPNRKN----HCPVYFFSEGMKRLVKKYKRSASQIVLRYLIDYG 289
            ..|:::|:...|::.|:..||....:|    ..||...:..:..:.||:.|:.:.:.:|||:..|
 Frog   201 SKLLEFCKSKDIVLVAYGVLGSSREENWVDQSTPVLLENPILGAIAKKHNRTPAHVAMRYLLQRG 265

  Fly   290 VVPIPKAANPIHIKENLNIF 309
            ||.:.|:..|..||||..:|
 Frog   266 VVVLAKSFTPARIKENFKVF 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 107/280 (38%)
Tas 50..324 CDD:223739 101/269 (38%)
LOC101733893XP_031746807.1 AKR_AKR1C1-35 7..286 CDD:381334 107/280 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm9378
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.