DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and LOC100494522

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_031746808.1 Gene:LOC100494522 / 100494522 -ID:- Length:263 Species:Xenopus tropicalis


Alignment Length:256 Identity:98/256 - (38%)
Similarity:147/256 - (57%) Gaps:12/256 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VRLSSGHEMPVLGFGTYKLRGYQCSAA---VHCAIETGFRHFDTAYYYENEKEIGEALRTQIKMG 102
            |.|:.||:|||||||||....:..|.|   ...||:.|:||.|.|:.|.||.|:|.|::.:|..|
 Frog     9 VELNDGHKMPVLGFGTYAPEKFPKSLAEEGTKVAIDVGYRHIDCAFIYGNEVEVGRAIKAKIADG 73

  Fly   103 NISRENIFLTTKLWNTHHDPRDVRRICEKQLELLGFSYIDLYLMHFPVGYKYVCDEILMPMSGDE 167
            .:.||::|.|.|||:|.|.|..||...||.|..|...|:||:::|.||.:|...|.:.:..:|..
 Frog    74 TVKREDVFYTGKLWSTFHTPERVRPALEKSLTDLQLDYMDLFIIHNPVEFKPGDDPLPLDENGKP 138

  Fly   168 LQTVEIDYLDTWRAMENLVKLGMVRSIGLSNFNMEQIQRIIQCS--SSKPVVNQVEIWPGFL-QK 229
            : ....|..|||:|:|.....|:|||||:||||.:|::.|:...  ..|||.||||. |.:| |.
 Frog   139 I-FHNTDLRDTWKALEKCKDAGLVRSIGVSNFNHKQLELILNMPGLKYKPVCNQVEC-PIYLDQS 201

  Fly   230 DLVDYCRYNGIIVTAFSPLGQPNRKN----HCPVYFFSEGMKRLVKKYKRSASQIVLRYLI 286
            .|:::|:...|::.|:..||....:|    ..||...:..:..:.||:.|:.:.:.:|||:
 Frog   202 KLLEFCKSKDIVLVAYGVLGSSREENWVDQSTPVLLENPILGAIAKKHNRTPAHVAMRYLL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 98/256 (38%)
Tas 50..324 CDD:223739 93/247 (38%)
LOC100494522XP_031746808.1 AKR_SF 8..263 CDD:412396 98/256 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.