DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpl6 and RpL6

DIOPT Version :9

Sequence 1:NP_035420.2 Gene:Rpl6 / 19988 MGIID:108057 Length:296 Species:Mus musculus
Sequence 2:NP_651876.1 Gene:RpL6 / 43723 FlyBaseID:FBgn0039857 Length:262 Species:Drosophila melanogaster


Alignment Length:270 Identity:127/270 - (47%)
Similarity:166/270 - (61%) Gaps:21/270 - (7%)


- Green bases have known domain annotations that are detailed below.


Mouse    34 AKKVHPKGKKPKKAKPHCSRNPVLVRGIGRYSRSAMYSRKALYKRKYSAAKTKVEKKK---KKEK 95
            ||||   .|..||.|.| ..|..|..||.|||::.||.|:|||:.|        :||.   :|.|
  Fly     7 AKKV---AKSAKKGKKH-PVNSYLKGGILRYSKAQMYKRRALYRLK--------DKKSPVVEKAK 59

Mouse    96 VLATVTKTVGGDKNGGTRVVKLRKMPRYYPTEDVPRKLLSHGKKPFSQHVRRLRSSITPGTVLII 160
            |.....|.:||.||||.|.|.|:|....|||:...:|..|  |..||:|.|..|.::|||||||:
  Fly    60 VPIKKVKKIGGPKNGGERTVFLKKSKASYPTKTFVKKRPS--KANFSEHKRNTRRNLTPGTVLIL 122

Mouse   161 LTGRHRGKRVVFLKQLDSGLLLVTGPLVINRVPLRRTHQKFVIATSTKVDISDVKIPKHLTDAYF 225
            |.|||:|||||.||.|.|||||||||..:|..||||..|::||.||:|||:...|:|:||.||||
  Fly   123 LAGRHQGKRVVLLKVLASGLLLVTGPFALNSCPLRRVSQRYVIGTSSKVDLGAFKVPEHLNDAYF 187

Mouse   226 KKKQLRKPRHQ-EGEIFDTEKEKYEITEQRKADQKAVDLQILPKIKAVPQ---LQGYLRSQFSLT 286
            ::.:.:|.:.. |.:||..:||::...||||.|||.||..:|..|||.|:   ...||::.|:|.
  Fly   188 RRLKAKKDKKTGEADIFAAKKERFVPNEQRKKDQKEVDAALLKVIKAHPEGKFFAKYLQNMFALH 252

Mouse   287 NGMYPHKLVF 296
            :..|||::.|
  Fly   253 SSQYPHRMRF 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpl6NP_035420.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53 9/18 (50%)
Ribosomal_L6e_N 50..103 CDD:367701 20/55 (36%)
KOW_RPL6 144..296 CDD:240520 79/155 (51%)
RpL6NP_651876.1 Ribosomal_L6e_N <23..>51 CDD:281813 14/35 (40%)
KOW_RPL6 106..262 CDD:240520 79/155 (51%)
RPL14A 111..234 CDD:225074 67/122 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830619
Domainoid 1 1.000 97 1.000 Domainoid score I7289
eggNOG 1 0.900 - - E1_COG2163
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31001
Inparanoid 1 1.050 212 1.000 Inparanoid score I3633
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53785
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001826
OrthoInspector 1 1.000 - - oto94654
orthoMCL 1 0.900 - - OOG6_101188
Panther 1 1.100 - - LDO PTHR10715
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1143
SonicParanoid 1 1.000 - - X1520
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.790

Return to query results.
Submit another query.