DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELF2 and Eip74EF

DIOPT Version :9

Sequence 1:NP_001317965.1 Gene:ELF2 / 1998 HGNCID:3317 Length:593 Species:Homo sapiens
Sequence 2:NP_001014590.1 Gene:Eip74EF / 39962 FlyBaseID:FBgn0000567 Length:883 Species:Drosophila melanogaster


Alignment Length:330 Identity:130/330 - (39%)
Similarity:171/330 - (51%) Gaps:67/330 - (20%)


- Green bases have known domain annotations that are detailed below.


Human     2 TSAVVDSGGTILELSSNG---VENQEESEKVSEYPAVIVEPVPSARLEQGYAAQVLVYDDETYMM 63
            |:|....|.||     ||   :..|::.::.|:          .::.:|..|.|.|.:..:..:.
  Fly   596 TAAASQRGTTI-----NGYHSLHQQQQQQQQSQ----------QSQQQQQLAHQQLSHQQQQALH 645

Human    64 QDVAEEQEVETE----------NVETVEASVHS---SNAHC---TDKTIEAAEALLHMESPTCLR 112
            |.::.:|:.:.:          |.....:..||   |:.|.   |..||.||.|   ..:.:.:.
  Fly   646 QQLSHQQQQQQQQQQQHPHSQLNGPHPHSHPHSHPHSHPHAGQHTHSTIAAAAA---AAAASVVS 707

Human   113 DSRSPVEVFVPPCVSTPEFIHAAM----RPDVITETVVEVSTEESEPMDTSPIPTSPDSHEPMKK 173
            .|.|.|........|......||.    ...||......||.:.|..::....        ..:|
  Fly   708 SSSSAVAAAAMLSASAAAAATAAAAAGGSQSVIQPATSSVSYDLSYMLELGGF--------QQRK 764

Human   174 KKVGRKPKTQQSPISNGSPELGIKKKPREGKGNTTYLWEFLLDLLQDKNTCPRYIKWTQREKGIF 238
            .|..||||.          |:|:|::.||  |:|||||||||.||||:..|||:||||.||||:|
  Fly   765 AKKPRKPKL----------EMGVKRRSRE--GSTTYLWEFLLKLLQDREYCPRFIKWTNREKGVF 817

Human   239 KLVDSKAVSKLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQFKDMPKNIVVIDDDK 303
            |||||||||:|||.||||||||||||||||||||||||||||:||||||||.|:||:|:.||   
  Fly   818 KLVDSKAVSRLWGMHKNKPDMNYETMGRALRYYYQRGILAKVDGQRLVYQFVDVPKDIIEID--- 879

Human   304 SETCN 308
               ||
  Fly   880 ---CN 881

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELF2NP_001317965.1 Elf-1_N 3..108 CDD:315071 25/123 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..201 12/54 (22%)
ETS 207..289 CDD:197710 71/81 (88%)
Eip74EFNP_001014590.1 Ets 789..869 CDD:278602 69/79 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 155 1.000 Domainoid score I4215
eggNOG 1 0.900 - - E1_KOG3804
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006321
OrthoInspector 1 1.000 - - otm40744
orthoMCL 1 0.900 - - OOG6_106781
Panther 1 1.100 - - O PTHR11849
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3979
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.