DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELF1 and Ets65A

DIOPT Version :9

Sequence 1:NP_001357259.1 Gene:ELF1 / 1997 HGNCID:3316 Length:619 Species:Homo sapiens
Sequence 2:NP_001303373.1 Gene:Ets65A / 38700 FlyBaseID:FBgn0005658 Length:728 Species:Drosophila melanogaster


Alignment Length:205 Identity:66/205 - (32%)
Similarity:85/205 - (41%) Gaps:58/205 - (28%)


- Green bases have known domain annotations that are detailed below.


Human   203 GKGNTIYLWEFLLALLQD--KATCPKYIKWTQREKGIFKLVDSKAVSRLWGKHKNKPDMNYETMG 265
            |.|. |.||:|||.||.|  .|:|   |.| :...|.|||.|...|:|.||:.|:||:|||:.:.
  Fly   313 GSGQ-IQLWQFLLELLSDSNNASC---ITW-EGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLS 372

Human   266 RALRYYYQRGILAKVEGQRLVYQF---------KEMPKDLIYINDED-----------------P 304
            |||||||.:.|:.||.|:|..|:|         :....|..|....|                 |
  Fly   373 RALRYYYDKNIMTKVHGKRYAYKFDFQGLAAATQPAASDPTYKYQSDLFMTPYHHSAKLSSFMSP 437

Human   305 SSSIESSDPSLSSSATSNRNQTSRSRVSSSPGVKGGATTVLKPGNSKAAKPKDPVEVAQPSEVLR 369
            ...:.||..|:..||.|..|.       .||     ||.:.:|.:.....|..            
  Fly   438 HHGMTSSSASIFPSAASWGNW-------GSP-----ATNLYQPHSMSHVTPSH------------ 478

Human   370 TVQPTQSPYP 379
             |.|..|.||
  Fly   479 -VAPHLSSYP 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELF1NP_001357259.1 Elf-1_N 2..111 CDD:372034
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..199
ETS 207..289 CDD:197710 41/83 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..366 15/82 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 564..592
Ets65ANP_001303373.1 ETS 316..401 CDD:197710 42/89 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.