Sequence 1: | XP_011539191.1 | Gene: | ELAVL4 / 1996 | HGNCID: | 3315 | Length: | 416 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_722615.1 | Gene: | spen / 44205 | FlyBaseID: | FBgn0016977 | Length: | 5560 | Species: | Drosophila melanogaster |
Alignment Length: | 274 | Identity: | 52/274 - (18%) |
---|---|---|---|
Similarity: | 107/274 - (39%) | Gaps: | 71/274 - (25%) |
- Green bases have known domain annotations that are detailed below.
Human 80 SKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSL-GYGFVNYIDPKDAEKAINTL 143
Human 144 NGLRLQTKTIKVSYAR--PSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTG 206
Human 207 VSRGVGFIRFDKRIEAEEAIKGLNG----------------------------QKPSGATEPITV 243
Human 244 KFANNPSQKSSQALLSQLYQSPNR--------RYPG----------PLHHQAQRFRLDNLLNMAY 290
Human 291 GVKRLMSGPVPPSA 304 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ELAVL4 | XP_011539191.1 | ELAV_HUD_SF | 79..415 | CDD:273741 | 52/274 (19%) |
spen | NP_722615.1 | RRM2_SHARP | 555..628 | CDD:240795 | |
RRM3_SHARP | 654..726 | CDD:240796 | 24/76 (32%) | ||
RRM4_SHARP | 727..803 | CDD:240797 | 12/87 (14%) | ||
RILP-like | 1997..>2055 | CDD:304877 | |||
SPOC | 5404..5527 | CDD:285043 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |