DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELAVL4 and spen

DIOPT Version :9

Sequence 1:XP_011539191.1 Gene:ELAVL4 / 1996 HGNCID:3315 Length:416 Species:Homo sapiens
Sequence 2:NP_722615.1 Gene:spen / 44205 FlyBaseID:FBgn0016977 Length:5560 Species:Drosophila melanogaster


Alignment Length:274 Identity:52/274 - (18%)
Similarity:107/274 - (39%) Gaps:71/274 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    80 SKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSL-GYGFVNYIDPKDAEKAINTL 143
            |...|.:..|.:::|..|.||.|.:.|||     :...|..|.| .|.|..|.|.....||:..:
  Fly   654 STRTLFIGNLEKDITAGELRSHFEAFGEI-----IEIDIKKQGLNAYAFCQYSDIVSVVKAMRKM 713

Human   144 NGLRLQTKTIKVSYAR--PSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTG 206
            :|..|.:..||:.:.:  |::.      :::.|:.:.:::..|:..|:::|.:  :::.:|:   
  Fly   714 DGEHLGSNRIKLGFGKSMPTNC------VWIDGVDEKVSESFLQSQFTRFGAV--TKVSIDR--- 767

Human   207 VSRGVGFIRFDKRIEAEEAIKGLNG----------------------------QKPSGATEPITV 243
             :|.:..:.:|:...|:.|:|.:.|                            |:.|..:.|...
  Fly   768 -NRQLALVLYDQVQNAQAAVKDMRGTILRRKKLQVDFASRECQDAFYDKQEKQQQQSSGSNPRFS 831

Human   244 KFANNPSQKSSQALLSQLYQSPNR--------RYPG----------PLHHQAQRFRLDNLLNMAY 290
            ::.::.|...|::..|...:..|.        ..||          .|.:|:....:.|:     
  Fly   832 RYESSASSLQSRSRASSFSRHQNNSNDDCSPINTPGGASSGISSASNLINQSTSINISNI----- 891

Human   291 GVKRLMSGPVPPSA 304
            |.....:.|.|..|
  Fly   892 GTNACSAMPAPSLA 905

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELAVL4XP_011539191.1 ELAV_HUD_SF 79..415 CDD:273741 52/274 (19%)
spenNP_722615.1 RRM2_SHARP 555..628 CDD:240795
RRM3_SHARP 654..726 CDD:240796 24/76 (32%)
RRM4_SHARP 727..803 CDD:240797 12/87 (14%)
RILP-like 1997..>2055 CDD:304877
SPOC 5404..5527 CDD:285043
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.