DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELAVL4 and CG6937

DIOPT Version :9

Sequence 1:XP_011539191.1 Gene:ELAVL4 / 1996 HGNCID:3315 Length:416 Species:Homo sapiens
Sequence 2:NP_651066.2 Gene:CG6937 / 42662 FlyBaseID:FBgn0038989 Length:356 Species:Drosophila melanogaster


Alignment Length:177 Identity:45/177 - (25%)
Similarity:79/177 - (44%) Gaps:10/177 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    84 LIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRL 148
            :||.:||....:::.|..|...|.:...:|.|...||.|.||.||.:..|:.|:.|.:|::...:
  Fly    53 VIVKHLPHGFFEQQLRQYFRQFGRVLRVRLARSLRTGNSKGYAFVEFEYPEVAKVAADTMDNYLM 117

Human   149 QTKTIKVSYARPSSASIRDANLYVSGLPKTMTQ--KEL--EQLFSQYGRIITSRILVDQVTGVSR 209
            ..|.:|.:|..|...::   |.:.:.|.|.:.:  ||:  ..|.....|.:..:...|:.....|
  Fly   118 FQKVVKATYIPPEKQTL---NFFRTSLKKVVNKAGKEIYVSDLTKATQRSVKKQNNWDESACQKR 179

Human   210 GVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFANNPSQKSSQA 256
            .|..:...|::  :|..|.|.....:...||:. |.|.:....:|||
  Fly   180 TVANLNKIKKL--QEKYKDLGIDFSNLLVEPVK-KAAGSAEASTSQA 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELAVL4XP_011539191.1 ELAV_HUD_SF 79..415 CDD:273741 45/177 (25%)
CG6937NP_651066.2 RRM <32..>170 CDD:223796 31/119 (26%)
RRM_NIFK_like 52..125 CDD:240753 22/71 (31%)
Upf2 253..>304 CDD:281974
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.