DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELAVL4 and nonA-l

DIOPT Version :9

Sequence 1:XP_011539191.1 Gene:ELAVL4 / 1996 HGNCID:3315 Length:416 Species:Homo sapiens
Sequence 2:NP_001262646.1 Gene:nonA-l / 42026 FlyBaseID:FBgn0015520 Length:630 Species:Drosophila melanogaster


Alignment Length:226 Identity:53/226 - (23%)
Similarity:89/226 - (39%) Gaps:34/226 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    77 TDD---SKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEK 138
            ||:   .:..|.|..|..:.|.::.|.:|...|||      .|..:.....:.|:.....::|||
  Fly   257 TDNKFVGRNRLYVGNLTSDTTDDDLREMFKPYGEI------GDIFSNPEKNFTFLRLDYYQNAEK 315

Human   139 AINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQ 203
            |...|:|...:.:.::|.:|..:...:.:.|.:||       .:.|.|.|..:|.|..:.|.||.
  Fly   316 AKRALDGSLRKGRVLRVRFAPNAIVRVTNLNQFVS-------NELLHQSFEIFGPIERAVICVDD 373

Human   204 VTGVSRGVGFIRFDKRIEAEEAIKGLNGQ--------KPSGATEPITVKFANNPSQKSSQALLSQ 260
             .|...|.|.:.|.|:..|...::..|.:        :|. ..||:.|.  |:......:.|..:
  Fly   374 -RGKHTGEGIVEFAKKSSASACLRLCNEKCFFLTASLRPC-LVEPMEVN--NDNDGLPDKTLNKK 434

Human   261 LYQSPNRRYPGPLHHQAQRFRLDNLLNMAYG 291
            ..:..:.|..||      ||...|.....||
  Fly   435 SLEFRHERSVGP------RFACLNSFEHEYG 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELAVL4XP_011539191.1 ELAV_HUD_SF 79..415 CDD:273741 51/224 (23%)
nonA-lNP_001262646.1 RRM1_p54nrb_like 264..334 CDD:240778 18/75 (24%)
RRM2_p54nrb_like 339..418 CDD:240779 21/87 (24%)
NOPS_NONA_like 409..508 CDD:240580 14/60 (23%)
OmpH <479..578 CDD:281871
DUF4472 479..559 CDD:291409
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.