DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELAVL4 and CG5213

DIOPT Version :9

Sequence 1:XP_011539191.1 Gene:ELAVL4 / 1996 HGNCID:3315 Length:416 Species:Homo sapiens
Sequence 2:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster


Alignment Length:226 Identity:82/226 - (36%)
Similarity:121/226 - (53%) Gaps:16/226 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    72 QTGATTDD--------SKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFV 128
            |||...|.        .|||||:|||||:||:.|...||...|||...|::|.:.||.|..||||
  Fly    23 QTGRPVDPPPPLPNLRMKTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFV 87

Human   129 NYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGR 193
            :|:..:.|..|:|.::|...:.|.:||::||||......::|||..||..|.:|::.:||:.||.
  Fly    88 DYVSERQAAAAVNGMDGYETRGKRLKVAFARPSEYESTSSSLYVGNLPTYMDEKKVRELFATYGN 152

Human   194 IITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFANNPSQKSSQALL 258
            |:...:|..:....||||.|::|:...:||.|..|::.....||:.|:||||.....:.||....
  Fly   153 IVDVNLLRHKFNNRSRGVAFLQFELVRDAEVAKYGMDRYMIEGASRPLTVKFVEREKKGSSSTSS 217

Human   259 SQLYQSPNRRYPGPL--------HHQAQRFR 281
            ...|:...:..|.|.        ||.::|.|
  Fly   218 GSQYKDKRKSSPPPYKRRERTNDHHVSKRSR 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELAVL4XP_011539191.1 ELAV_HUD_SF 79..415 CDD:273741 78/219 (36%)
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 34/75 (45%)
RRM 128..202 CDD:214636 26/73 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.