DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELAVL4 and mug28

DIOPT Version :9

Sequence 1:XP_011539191.1 Gene:ELAVL4 / 1996 HGNCID:3315 Length:416 Species:Homo sapiens
Sequence 2:NP_593427.1 Gene:mug28 / 2543165 PomBaseID:SPAC343.07 Length:609 Species:Schizosaccharomyces pombe


Alignment Length:254 Identity:64/254 - (25%)
Similarity:94/254 - (37%) Gaps:66/254 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    69 SPMQTGATTDDSKTNLIVNYLPQNM--TQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYI 131
            :|..|...|.| ..||.|..|..|:  ..::...||...|.|:||.|.....|..|.|||||::.
pombe   407 TPTPTSTPTID-PCNLFVKNLDDNIVGNTQQLEELFSKFGRIKSCTLASYPSTEISKGYGFVSFS 470

Human   132 DPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQ-YGRII 195
            .|.:|.:|||||||:....|.:.|:||.                .:...:|.|..:||| |..::
pombe   471 HPFEAVQAINTLNGVLFGKKRLFVNYAE----------------KREDRKKRLSAIFSQSYPPVV 519

Human   196 TSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFANNPSQKSSQALLSQ 260
            .|..|...:                                ||||..:::.....|...|::...
pombe   520 PSPSLTIPM--------------------------------ATEPQILEYHQEWPQPLIQSIQQH 552

Human   261 LYQSPNRRYPGPLHHQAQRFR----LDNLLNMA--YGVKRLMSGPVPPSACPPRFSPIT 313
            .|..|.:..|..|...|.:.|    .:..||.:  :|:|.        |......||:|
pombe   553 GYSDPRQTLPTRLDSCAAKLREAVISNENLNPSHKFGIKH--------STFKTSLSPLT 603

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELAVL4XP_011539191.1 ELAV_HUD_SF 79..415 CDD:273741 61/244 (25%)
mug28NP_593427.1 RRM <8..>127 CDD:223796
RRM1_NEFsp 21..100 CDD:240719
RRM 150..505 CDD:223796 36/114 (32%)
RRM_SF 274..342 CDD:240668
RRM_SF 417..496 CDD:302621 31/79 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10352
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.