DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELAVL1 and elavl1

DIOPT Version :9

Sequence 1:NP_001410.2 Gene:ELAVL1 / 1994 HGNCID:3312 Length:326 Species:Homo sapiens
Sequence 2:NP_001005461.1 Gene:elavl1 / 448062 XenbaseID:XB-GENE-481800 Length:326 Species:Xenopus tropicalis


Alignment Length:326 Identity:303/326 - (92%)
Similarity:309/326 - (94%) Gaps:0/326 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSNGYEDHMAEDCRGDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGF 65
            |||||.|||.:.||.||||||||||||||||||||||||||||||||||||||||||||||||||
 Frog     1 MSNGYGDHMDDVCRDDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGF 65

Human    66 VNYVTAKDAERAINTLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQKDVEDMFSRFG 130
            |||:.||||||||||||||||||||||||.||||||.||||||||||||||||||||||||..||
 Frog    66 VNYLNAKDAERAINTLNGLRLQSKTIKVSVARPSSESIKDANLYISGLPRTMTQKDVEDMFLPFG 130

Human   131 RIINSRVLVDQTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPITVKFAANPNQNKNVAL 195
            |||||||||||.||||||||||||||||||||||.|||||||||||||||||||||||||||:||
 Frog   131 RIINSRVLVDQATGLSRGVAFIRFDKRSEAEEAIASFNGHKPPGSSEPITVKFAANPNQNKNMAL 195

Human   196 LSQLYHSPARRFGGPVHHQAQRFRFSPMGVDHMSGLSGVNVPGNASSGWCIFIYNLGQDADEGIL 260
            ||||.|||||||||||||||||||||||||||||.:|||||..:|||||||||||||||||||||
 Frog   196 LSQLCHSPARRFGGPVHHQAQRFRFSPMGVDHMSSISGVNVASSASSGWCIFIYNLGQDADEGIL 260

Human   261 WQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVSFKTNKSH 325
            |||||||||||||||||||||||||||||||||||||||||||||||||||||.|||.|||:|||
 Frog   261 WQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKTLQVFFKTSKSH 325

Human   326 K 326
            |
 Frog   326 K 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELAVL1NP_001410.2 ELAV_HUD_SF 19..326 CDD:273741 288/306 (94%)
elavl1NP_001005461.1 RRM 19..326 CDD:330708 288/306 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 145 1.000 Domainoid score I21917
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H20367
Inparanoid 1 1.050 606 1.000 Inparanoid score I6373
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG55893
OrthoDB 1 1.010 - - D176141at32523
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 1 1.000 - - otm55033
Panther 1 1.100 - - LDO PTHR10352
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X326
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1313.080

Return to query results.
Submit another query.