DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELAVL1 and Rbp9

DIOPT Version :9

Sequence 1:NP_001410.2 Gene:ELAVL1 / 1994 HGNCID:3312 Length:326 Species:Homo sapiens
Sequence 2:NP_001259974.1 Gene:Rbp9 / 33498 FlyBaseID:FBgn0010263 Length:684 Species:Drosophila melanogaster


Alignment Length:331 Identity:202/331 - (61%)
Similarity:241/331 - (72%) Gaps:28/331 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    19 RTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAERAINTLNG 83
            :||||||||||.|:|||:||||.|.|||||.|||||||.|.||||||||||..:|||:|||.|||
  Fly   109 KTNLIVNYLPQTMSQDEIRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVKQEDAEKAINALNG 173

Human    84 LRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQKDVEDMFSRFGRIINSRVLVDQTTGLSRG 148
            ||||:||||||.||||||.||.||||:||||:.|||.|:|.:||.:|:||.||:|.|..||||:|
  Fly   174 LRLQNKTIKVSIARPSSESIKGANLYVSGLPKNMTQSDLESLFSPYGKIITSRILCDNITGLSKG 238

Human   149 VAFIRFDKRSEAEEAITSFNGHKPPGSSEPITVKFAANPNQNKNVALLSQLYHSPARRFGG---- 209
            |.|||||:|.||:.||...||..|..|:||||||||.||:.|||.......|.:|....||    
  Fly   239 VGFIRFDQRFEADRAIKELNGTTPKNSTEPITVKFANNPSSNKNSMQPLAAYIAPQNTRGGRAFP 303

Human   210 --------------PVHHQAQRF-----RFSPMGVDHMSGLSGVNVPGN--ASSGWCIFIYNLGQ 253
                          .:|..|.|:     |:||:..|.::  :|: :.||  ||||||||:|||..
  Fly   304 ANAAAGAAAAAAAAAIHPNAGRYSSVISRYSPLTSDLIT--NGM-IQGNTIASSGWCIFVYNLAP 365

Human   254 DADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVS 318
            |.:|.:|||:|||||||.:||||||..:|||||||||||||||||.:||.|||||.||:::||||
  Fly   366 DTEENVLWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYEEAVLAIQSLNGYTLGNRVLQVS 430

Human   319 FKTNKS 324
            |||||:
  Fly   431 FKTNKN 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELAVL1NP_001410.2 ELAV_HUD_SF 19..326 CDD:273741 202/331 (61%)
Rbp9NP_001259974.1 ELAV_HUD_SF 107..438 CDD:273741 202/331 (61%)
RRM1_Hu 109..186 CDD:241094 61/76 (80%)
RRM2_Hu 196..274 CDD:241096 48/77 (62%)
RRM3_Hu 355..432 CDD:240823 56/76 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 121 1.000 Domainoid score I5685
eggNOG 1 0.900 - - E1_KOG0145
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 419 1.000 Inparanoid score I1806
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D425303at33208
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 1 1.000 - - mtm8515
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10352
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X326
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.930

Return to query results.
Submit another query.