DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINB1 and Spn88Eb

DIOPT Version :9

Sequence 1:NP_109591.1 Gene:SERPINB1 / 1992 HGNCID:3311 Length:379 Species:Homo sapiens
Sequence 2:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster


Alignment Length:410 Identity:110/410 - (26%)
Similarity:197/410 - (48%) Gaps:54/410 - (13%)


- Green bases have known domain annotations that are detailed below.


Human     3 QLSSANTRFALDLFLALSENNPAGNIFISPFSISSAMAMVFLGTRGNTAAQLSKTFHFN------ 61
            |:......|:|.|...:.|..|:||:|.||||..:|:.:.:..:...|..:|::..:..      
  Fly    33 QIFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQ 97

Human    62 ------TVEEVHSRFQSLNADINKRGASYILKLANRLYGEKTYNFLPEFLVSTQKTYGADLASVD 120
                  |:.:....|:       .|.:...|..|||::.::|.|...:|   ....||| ...:|
  Fly    98 QVLVSYTLAQRQDEFR-------WRQSPMELSSANRIFVDRTINVSNKF---NTLLYGA-TKELD 151

Human   121 FQHASEDARKTINQWVKGQTEGKIPELLASGMVDNMTKLVLVNAIYFKGNWKDKFMKEATTNAPF 185
            |::..|...|.||.|:..:|..:|.::|:|..:...|.|||.||.|.||.|..:|..|.|...||
  Fly   152 FKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPF 216

Human   186 RLNKKDRKTVKMMYQKKKFAYGYIEDLKCRVLELPYQ---------------GEELSMVILLPDD 235
            .:|:::::.|.||::...|.....|.|:.::::|||:               ..::||:|:||: 
  Fly   217 FINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPN- 280

Human   236 IEDESTGLKKIEEQLTLEKLHEWTK---PENLDFIEVNVSLPRFKLEESYTLNSDLARLGVQDLF 297
              .....|.::..:|..:.:.:|.:   |:     ::.:|||:|:.|:...|...|:.:||..:|
  Fly   281 --SNKISLNRVISRLNADSVKKWFERALPQ-----KIELSLPKFQFEQRLELTPILSLMGVNTMF 338

Human   298 --NSSKADLSGMSGARDIFISKIVHKSFVEVNEEGTEAAAATAGIATFCMLMPE-ENFTADHPFL 359
              |::..||:  :....:.|....|.:.::|:|.|:.|||||..:.:.....|: ..|..:|||:
  Fly   339 TRNATFGDLT--ADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFV 401

Human   360 FFIRHNSSGSILFLGRFSSP 379
            |.|......:|||.|.:|.|
  Fly   402 FLIYDEKVDTILFAGVYSDP 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINB1NP_109591.1 SERPIN 4..379 CDD:294093 108/407 (27%)
CARD-binding motif (CBM). /evidence=ECO:0000269|PubMed:30692621 351..379 11/27 (41%)
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 107/401 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.