DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND1 and ndhA

DIOPT Version :9

Sequence 1:YP_009047278.1 Gene:ND1 / 19893558 FlyBaseID:FBgn0013679 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_051114.1 Gene:ndhA / 844804 -ID:- Length:360 Species:Arabidopsis thaliana


Alignment Length:330 Identity:107/330 - (32%)
Similarity:161/330 - (48%) Gaps:36/330 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LIICVLVSVAFLTLLERKVLGYIQIRKGPNKVGLMGIPQPFCDAIKLFTKEQTYPLLSNYLSYYI 77
            |::.::..|..:..|||::...||.|.||...|.:||.|...|..||..||...|...|...:.|
plant    36 LVLGIITGVLVIVWLEREISAGIQQRIGPEYAGPLGILQALADGTKLLFKENLRPSRGNTPLFSI 100

  Fly    78 SPIFSLFLSLFVWMCMPF--FVKLYSFNLGGLFFLCCTSLGVYTVMVAGWSSNSNYALLGGLRAV 140
            .|..::...|..:..:||  .:.|...|:|...::..:|:....::::|:.||:.|:.||||||.
plant   101 GPSIAVISILLSYSVIPFSNHLVLADLNIGIFLWIAISSIAPIGLLMSGYGSNNKYSFLGGLRAA 165

  Fly   141 AQTISYEVSLALILLSFIFLIGSYNMI-------YFFFYQVYMWFLIILFPMALVWMSISLAETN 198
            ||:||||:.|.|.:||...|..|.:.:       .:.|:...:|...|.|   ::::..||||..
plant   166 AQSISYEIPLTLCVLSISLLSNSLSTVDIVEAQSKYGFWGWNLWRQPIGF---IIFLISSLAECE 227

  Fly   199 RTPFDFAEGESELVSGFNVEYSSGGFALIFMAEYASILFMSMLFCVIFLG-----------CDVF 252
            |.|||..|.|.||::|:..|||...|.|.::|.|.::|..|:...|::||           .::|
plant   228 RLPFDLPEAEEELIAGYQTEYSGIKFGLFYVASYLNLLISSLFVTVLYLGGWNISIPYISILELF 292

  Fly   253 N-----------LLFYMKLTFISFVFIWVRGTLPRFRYDKLMYLAWKCFLSFSLNYLLFFIGFKI 306
            .           .:...|.....||.|..|.||||.|.|:|:.|.||..|..||..||....|: 
plant   293 QRDQIFGTTIGIFITLAKTYLFLFVSIATRWTLPRLRMDQLLNLGWKFLLPISLGNLLLTTSFQ- 356

  Fly   307 LLFSL 311
             ||||
plant   357 -LFSL 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND1YP_009047278.1 ND1 16..308 CDD:177241 102/322 (32%)
ndhANP_051114.1 ndhA 1..360 CDD:214341 105/328 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214989at2759
OrthoFinder 1 1.000 - - FOG0003668
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101576
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2539
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.