DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND1 and AT2G07785

DIOPT Version :9

Sequence 1:YP_009047278.1 Gene:ND1 / 19893558 FlyBaseID:FBgn0013679 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_973440.1 Gene:AT2G07785 / 2745467 AraportID:AT2G07785 Length:99 Species:Arabidopsis thaliana


Alignment Length:99 Identity:37/99 - (37%)
Similarity:57/99 - (57%) Gaps:2/99 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LGYIQIRKGPNKVGLMGIPQPFCDAIKLFTKEQTYPLLSNYLSYYISPIFSLFLSLFVWMCMPF- 95
            :.::|.||||:.||..|:.||..|..||..||...|..:|:..:.::|:.:..|||.....:|| 
plant     1 MAFVQRRKGPDVVGSFGLLQPLADGSKLILKEPISPSSANFFLFRMAPVATFMLSLVARAVVPFD 65

  Fly    96 -FVKLYSFNLGGLFFLCCTSLGVYTVMVAGWSSN 128
             .:.|...|:|.|:....:|||||.:::||.|||
plant    66 YGMVLSDPNIGLLYLFAISSLGVYGIIIAGRSSN 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND1YP_009047278.1 ND1 16..308 CDD:177241 37/99 (37%)
AT2G07785NP_973440.1 NADHdh 1..>99 CDD:395094 35/97 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 261 1.000 Domainoid score I479
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 262 1.000 Inparanoid score I966
OMA 1 1.010 - - QHG55628
OrthoDB 1 1.010 - - D1214989at2759
OrthoFinder 1 1.000 - - FOG0003668
OrthoInspector 1 1.000 - - otm3440
orthoMCL 1 0.900 - - OOG6_101576
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2539
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.880

Return to query results.
Submit another query.