DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYTB and BI3

DIOPT Version :9

Sequence 1:YP_009047277.1 Gene:CYTB / 19893556 FlyBaseID:FBgn0013678 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_009317.1 Gene:BI3 / 854605 SGDID:S000007272 Length:517 Species:Saccharomyces cerevisiae


Alignment Length:221 Identity:106/221 - (47%)
Similarity:150/221 - (67%) Gaps:13/221 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RNSHPLFKIANNALVDLPAPINISSWWNFGSLLGLCLIIQILTGLFLAMHYTADINLAFYSVNHI 70
            |.|:....:.|:.::|.|.|.:|:.|||.||||||||:|||:||:|:||||:::|.|||.||.||
Yeast     4 RKSNVYLSLVNSYIIDSPQPSSINYWWNMGSLLGLCLVIQIVTGIFMAMHYSSNIELAFSSVEHI 68

  Fly    71 CRDVNYGWLLRTLHANGASFFFICIYLHVGRGIYYGSYKFTP---TWLIGVIILFLVMGTAFMGY 132
            .|||:.|::||.||||||||||:.:::|:.:|:|||||: :|   .|.:||||..|.:.|||:||
Yeast    69 MRDVHNGYILRYLHANGASFFFMVMFMHMAKGLYYGSYR-SPRVTLWNVGVIIFILTIATAFLGY 132

  Fly   133 VLPWGQMSFWGATVITNLLSAIPYLGMDLVQWLWGGFAVDNATLTRFFTFHFILPFIVLAMTM-- 195
            ...:||||.|||||||||.||||::|.|:|.||||||.:::...:.......:|.:.:....|  
Yeast   133 CCVYGQMSHWGATVITNLFSAIPFVGNDIVSWLWGGFNMEDPYYSNMMLNKSVLCWNIFIWMMNY 197

  Fly   196 --IHLLFLHQTGSNNPIGLNSNIDKI 219
              |.|:..     ||.|...:|:.|:
Yeast   198 YIIQLIIY-----NNMIWNKNNMVKM 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYTBYP_009047277.1 CYTB 12..367 CDD:214440 104/215 (48%)
BI3NP_009317.1 Cytochrome_b_N 8..174 CDD:238176 95/166 (57%)
LAGLIDADG_1 270..367 CDD:279328
LAGLIDADG_1 405..499 CDD:279328
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346805
Domainoid 1 1.000 248 1.000 Domainoid score I350
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19271
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1779
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.